ACTL8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACTL8_HUMAN
• UniProt AC: Q9H568
• Protein Name: Actin-like protein 8
• Gene Name: ACTL8
• Organism: Homo sapiens (Human).
• Sequence Length: 366
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Sequence: MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Ubiquitination	DHGSGFLKAGTAGWN ECCCCCCCCCCCCCC	42.37	21963094
19	Phosphorylation	SGFLKAGTAGWNEPQ CCCCCCCCCCCCCCC	27.19	20068231
35	Phosphorylation	VFPNIVNYLPCKENP CCCCCHHCCCCCCCC	10.92	20068231
39	Ubiquitination	IVNYLPCKENPGPSY CHHCCCCCCCCCCCH	59.60	21963094
52	Phosphorylation	SYARRRVSLGIDICH CHHHHHHEECCEECC	21.04	24732914
62	Phosphorylation	IDICHPDTFSYPIER CEECCCCCCCCCCCC	20.94	24732914
64	Phosphorylation	ICHPDTFSYPIERGR ECCCCCCCCCCCCCC	31.90	24732914
65	Phosphorylation	CHPDTFSYPIERGRI CCCCCCCCCCCCCCC	12.21	24732914
103	Phosphorylation	PPVIITETPLREPAD CCEEEECCCCCCCCC	20.97	24719451
171	Acetylation	RPLPASGKTLEFAGQ CCCCCCCCEEEECCC	47.65	26051181
171	Ubiquitination	RPLPASGKTLEFAGQ CCCCCCCCEEEECCC	47.65	21963094
186	Ubiquitination	DLSAYLLKSLFKEDC HHHHHHHHHHCCCCC	42.38	21963094
187	Phosphorylation	LSAYLLKSLFKEDCD HHHHHHHHHCCCCCC	38.72	24719451
190	Ubiquitination	YLLKSLFKEDCDRRC HHHHHHCCCCCCCCC	58.92	21963094
211	Ubiquitination	VAVTQMNKCYVPQNL EEEEECCCCCCCCCH	22.92	21963094
238	Phosphorylation	ALDESNTYQLPDGSR HCCCCCCEECCCCCC	16.59	50563343
244	Phosphorylation	TYQLPDGSRVELTPM CEECCCCCCEEECCC	40.30	50563347
309	Ubiquitination	TLYPGFTKRLFRELM CCCCCHHHHHHHHHH	44.86	21963094
321	Phosphorylation	ELMGDHVSSTKATVW HHHCCCCCCCCEEEE	28.95	20068231
322	Phosphorylation	LMGDHVSSTKATVWE HHCCCCCCCCEEEEC	32.60	20068231
323	Phosphorylation	MGDHVSSTKATVWEG HCCCCCCCCEEEECC	19.72	20068231
324	Ubiquitination	GDHVSSTKATVWEGS CCCCCCCCEEEECCC	43.97	21963094
324	Acetylation	GDHVSSTKATVWEGS CCCCCCCCEEEECCC	43.97	26051181
357	Dimethylation	YQSEWMSREEYGEHM HHHHHHCHHHHHHHC	25.35	-
365	Dimethylation	EEYGEHMRM------ HHHHHHCCC------	29.57	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACTL8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACTL8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACTL8_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ACTL8_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.