UniProt ID | CBX2_MOUSE | |
---|---|---|
UniProt AC | P30658 | |
Protein Name | Chromobox protein homolog 2 | |
Gene Name | Cbx2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 519 | |
Subcellular Localization | Nucleus speckle . Chromosome . Localizes to the inactivated X chromosome in females. | |
Protein Description | Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (By similarity). PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (By similarity). Binds to histone H3 trimethylated at 'Lys-9' (H3K9me3) or at 'Lys-27' (H3K27me3). [PubMed: 16537902 Plays a role in the lineage differentiation of the germ layers in embryonic development] | |
Protein Sequence | MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKHTVTSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEEDDSDLDSKRGPRGRETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKAARRPVSLAKVLKTTRKDLGTSAAKLPPPLSAPVAGLAALKAHTKEACGGPSTMATPENLASLMKGMAGSPSRGGIWQSSIVHYMNRMSQSQVQAASRLALKAQATNKCGLGLDLKVRTQKGGELGGSPAGGKVPKAPGGGAAEQQRGNHSGSPGAQLAPTQELSLQVLDLQSVKNGVPGVGLLARHAPAKAIPATNPATGKGPGSGPTGANMTNAPTDNNKGEKLTCKATALPAPSVKRDTVKSVAASGGQEGHTAPGEGRKPPALSELSTGEENSSSDSDPDSTSLPSAAQNLSVAIQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
87 | Phosphorylation | PRKHTVTSSCSRRSK CCCCCCCCHHCCCHH | 25.63 | 22871156 | |
88 | Phosphorylation | RKHTVTSSCSRRSKL CCCCCCCHHCCCHHC | 13.52 | 22871156 | |
167 | Dimethylation | PIRKKRGRKPLPPEQ HHHHCCCCCCCCHHH | 41.26 | - | |
245 | Phosphorylation | LMKGMAGSPSRGGIW HHHHHCCCCCCCCCC | 15.34 | 27717184 | |
248 | Asymmetric dimethylarginine | GMAGSPSRGGIWQSS HHCCCCCCCCCCHHH | 51.22 | - | |
248 | Methylation | GMAGSPSRGGIWQSS HHCCCCCCCCCCHHH | 51.22 | 24129315 | |
303 | Phosphorylation | KGGELGGSPAGGKVP CCCCCCCCCCCCCCC | 15.13 | 26824392 | |
326 | Phosphorylation | EQQRGNHSGSPGAQL HHCCCCCCCCCCCCC | 44.99 | 26745281 | |
328 | Phosphorylation | QRGNHSGSPGAQLAP CCCCCCCCCCCCCCC | 24.15 | 23984901 | |
336 | Phosphorylation | PGAQLAPTQELSLQV CCCCCCCCCCEEEEE | 29.12 | 23984901 | |
340 | Phosphorylation | LAPTQELSLQVLDLQ CCCCCCEEEEEECHH | 18.92 | 26745281 | |
507 | Phosphorylation | ITVTVKESPTSVGFF EEEEECCCCCEEECE | 27.97 | 28066266 | |
509 | Phosphorylation | VTVKESPTSVGFFNL EEECCCCCEEECEEC | 45.37 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CBX2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBX2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBX2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PHC1_HUMAN | PHC1 | physical | 12167701 | |
BMI1_HUMAN | BMI1 | physical | 12167701 | |
RING1_HUMAN | RING1 | physical | 12167701 | |
CBX4_HUMAN | CBX4 | physical | 12167701 | |
PHC3_HUMAN | PHC3 | physical | 12167701 | |
SMCA5_HUMAN | SMARCA5 | physical | 12167701 | |
SCMH1_HUMAN | SCMH1 | physical | 12167701 | |
HSP74_HUMAN | HSPA4 | physical | 12167701 | |
PHC2_HUMAN | PHC2 | physical | 12167701 | |
BMI1_MOUSE | Bmi1 | physical | 9571155 | |
PHC1_MOUSE | Phc1 | physical | 9571155 | |
RING1_MOUSE | Ring1 | physical | 9312051 | |
H33_MOUSE | H3f3a | physical | 20493168 | |
NRAM1_MOUSE | Slc11a1 | physical | 17726103 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...