RUVB2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RUVB2_MOUSE
• UniProt AC: Q9WTM5
• Protein Name: RuvB-like 2
• Gene Name: Ruvbl2
• Organism: Mus musculus (Mouse).
• Sequence Length: 463
• Subcellular Localization: Nucleus.
• Protein Description: Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity.; Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).; Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.; Plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. May also inhibit the transcriptional activity of ATF2 (By similarity).; Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway where it negatively regulates expression of ER stress response genes..
• Protein Sequence: MATVAATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MATVAATTK ------CCCCCCCCC	15.69	-
9	Acetylation	ATVAATTKVPEIRDV CCCCCCCCCCCHHCC	51.98	23806337
43	Phosphorylation	ALEPRQASQGMVGQL CCCHHHHCCHHHHHH	20.94	28285833
215	Phosphorylation	SFTRARDYDAMGSQT CCCCCCCCCCCCCCC	10.47	29514104
227	Glutathionylation	SQTKFVQCPDGELQK CCCEEEECCCCHHHH	2.52	24333276
358	Phosphorylation	LDRLLIVSTSPYSEK HCCEEEEECCCCCCC	19.04	28066266
359	Phosphorylation	DRLLIVSTSPYSEKD CCEEEEECCCCCCCC	23.87	28066266
360	Phosphorylation	RLLIVSTSPYSEKDT CEEEEECCCCCCCCH	17.84	28066266
363	Phosphorylation	IVSTSPYSEKDTKQI EEECCCCCCCCHHHH	41.37	28066266
365	Acetylation	STSPYSEKDTKQILR ECCCCCCCCHHHHEE	65.83	23806337
365	Succinylation	STSPYSEKDTKQILR ECCCCCCCCHHHHEE	65.83	23954790
365	Malonylation	STSPYSEKDTKQILR ECCCCCCCCHHHHEE	65.83	26320211
419	Phosphorylation	VCRKRKGTEVQVDDI HHHHCCCCEEEHHHH	35.70	27841257
427	Acetylation	EVQVDDIKRVYSLFL EEEHHHHHHHHHHHH	42.69	23954790
427	Ubiquitination	EVQVDDIKRVYSLFL EEEHHHHHHHHHHHH	42.69	-
431	Phosphorylation	DDIKRVYSLFLDESR HHHHHHHHHHHCCHH	15.13	25338131
437	Phosphorylation	YSLFLDESRSTQYMK HHHHHCCHHCHHHHH	31.06	-
459	Phosphorylation	FNELKGETMDTS--- HHHHCCCCCCCC---	29.08	25338131
462	Phosphorylation	LKGETMDTS------ HCCCCCCCC------	26.05	29899451
463	Phosphorylation	KGETMDTS------- CCCCCCCC-------	33.68	25338131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RUVB2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RUVB2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RUVB2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RUVB1_MOUSE	Ruvbl1	physical	20211142
ACL6A_HUMAN	ACTL6A	physical	26496610
ZNHI2_HUMAN	ZNHIT2	physical	26496610
NFRKB_HUMAN	NFRKB	physical	26496610
PFD2_HUMAN	PFDN2	physical	26496610
RPB1_HUMAN	POLR2A	physical	26496610
2ABA_HUMAN	PPP2R2A	physical	26496610
PRKDC_HUMAN	PRKDC	physical	26496610
SPT6H_HUMAN	SUPT6H	physical	26496610
VPS72_HUMAN	VPS72	physical	26496610
TYY1_HUMAN	YY1	physical	26496610
YETS4_HUMAN	YEATS4	physical	26496610
TRRAP_HUMAN	TRRAP	physical	26496610
MRCKA_HUMAN	CDC42BPA	physical	26496610
RUVB1_HUMAN	RUVBL1	physical	26496610
RMP_HUMAN	URI1	physical	26496610
MO4L2_HUMAN	MORF4L2	physical	26496610
TTI1_HUMAN	TTI1	physical	26496610
ZNHI1_HUMAN	ZNHIT1	physical	26496610
PFD6_HUMAN	PFDN6	physical	26496610
KAT5_HUMAN	KAT5	physical	26496610
SRCAP_HUMAN	SRCAP	physical	26496610
BRD8_HUMAN	BRD8	physical	26496610
DPCD_HUMAN	DPCD	physical	26496610
EPC2_HUMAN	EPC2	physical	26496610
TFPT_HUMAN	TFPT	physical	26496610
UCHL5_HUMAN	UCHL5	physical	26496610
NOP58_HUMAN	NOP58	physical	26496610
ING3_HUMAN	ING3	physical	26496610
INO80_HUMAN	INO80	physical	26496610
MBTD1_HUMAN	MBTD1	physical	26496610
IN80D_HUMAN	INO80D	physical	26496610
PIHD1_HUMAN	PIH1D1	physical	26496610
MRGBP_HUMAN	MRGBP	physical	26496610
DMAP1_HUMAN	DMAP1	physical	26496610
CHM1B_HUMAN	CHMP1B	physical	26496610
EP400_HUMAN	EP400	physical	26496610
ARP6_HUMAN	ACTR6	physical	26496610
RPAP3_HUMAN	RPAP3	physical	26496610
RPAP2_HUMAN	RPAP2	physical	26496610
ARP5_HUMAN	ACTR5	physical	26496610
TTI2_HUMAN	TTI2	physical	26496610
WDCP_HUMAN	C2orf44	physical	26496610
EPC1_HUMAN	EPC1	physical	26496610
PDRG1_HUMAN	PDRG1	physical	26496610
IN80B_HUMAN	INO80B	physical	26496610
ARP8_HUMAN	ACTR8	physical	26496610
CL045_HUMAN	C12orf45	physical	26496610
IN80C_HUMAN	INO80C	physical	26496610
IN80E_HUMAN	INO80E	physical	26496610
WDR92_HUMAN	WDR92	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.