| UniProt ID | ZNHI1_HUMAN | |
|---|---|---|
| UniProt AC | O43257 | |
| Protein Name | Zinc finger HIT domain-containing protein 1 | |
| Gene Name | ZNHIT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 154 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Seems to play a role in p53-mediated apoptosis induction. Binds to NR1D2 and relieves it of its inhibitory effect on the transcription of APOC3 without affecting its DNA-binding activity.. | |
| Protein Sequence | MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 53 | Ubiquitination | AGLPQLGKRLPQFDD CCHHHHHHHCCCCCC | 60.39 | 22817900 | |
| 53 | Acetylation | AGLPQLGKRLPQFDD CCHHHHHHHCCCCCC | 60.39 | 25953088 | |
| 66 | Acetylation | DDDADTGKKKKKTRG CCCCCCCCCCCCCCC | 64.61 | 23954790 | |
| 66 | Ubiquitination | DDDADTGKKKKKTRG CCCCCCCCCCCCCCC | 64.61 | 29967540 | |
| 67 | Ubiquitination | DDADTGKKKKKTRGD CCCCCCCCCCCCCCC | 71.78 | 24816145 | |
| 67 | Acetylation | DDADTGKKKKKTRGD CCCCCCCCCCCCCCC | 71.78 | 25953088 | |
| 68 | Ubiquitination | DADTGKKKKKTRGDH CCCCCCCCCCCCCCH | 64.09 | 22817900 | |
| 82 | Ubiquitination | HFKLRFRKNFQALLE HHHHHHHHHHHHHHH | 60.44 | 24816145 | |
| 103 | Phosphorylation | AEGPNYLTACAGPPS HCCCCCEEECCCCCC | 14.88 | 22817900 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZNHI1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZNHI1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| H2AZ_HUMAN | H2AFZ | physical | 20473270 | |
| ARP6_HUMAN | ACTR6 | physical | 20473270 | |
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
| ACL6A_HUMAN | ACTL6A | physical | 28561026 | |
| ARP6_HUMAN | ACTR6 | physical | 28561026 | |
| DMAP1_HUMAN | DMAP1 | physical | 28561026 | |
| RUVB1_HUMAN | RUVBL1 | physical | 28561026 | |
| RUVB2_HUMAN | RUVBL2 | physical | 28561026 | |
| SRCAP_HUMAN | SRCAP | physical | 28561026 | |
| VPS72_HUMAN | VPS72 | physical | 28561026 | |
| YETS4_HUMAN | YEATS4 | physical | 28561026 | |
| ZNHI1_HUMAN | ZNHIT1 | physical | 28561026 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A new p38 MAP kinase-regulated transcriptional coactivator thatstimulates p53-dependent apoptosis."; Cuadrado A., Lafarga V., Cheung P.C., Dolado I., Llanos S., Cohen P.,Nebreda A.R.; EMBO J. 26:2115-2126(2007). Cited for: INTERACTION WITH MAPK11 AND MAPK14, PHOSPHORYLATION AT THR-103 BYMAPK11 AND MAPK14, INDUCTION BY DNA DAMAGE, FUNCTION, AND MUTAGENESISOF THR-103. | |