UniProt ID | ZNHI1_HUMAN | |
---|---|---|
UniProt AC | O43257 | |
Protein Name | Zinc finger HIT domain-containing protein 1 | |
Gene Name | ZNHIT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 154 | |
Subcellular Localization | Nucleus . | |
Protein Description | Seems to play a role in p53-mediated apoptosis induction. Binds to NR1D2 and relieves it of its inhibitory effect on the transcription of APOC3 without affecting its DNA-binding activity.. | |
Protein Sequence | MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | Ubiquitination | AGLPQLGKRLPQFDD CCHHHHHHHCCCCCC | 60.39 | 22817900 | |
53 | Acetylation | AGLPQLGKRLPQFDD CCHHHHHHHCCCCCC | 60.39 | 25953088 | |
66 | Acetylation | DDDADTGKKKKKTRG CCCCCCCCCCCCCCC | 64.61 | 23954790 | |
66 | Ubiquitination | DDDADTGKKKKKTRG CCCCCCCCCCCCCCC | 64.61 | 29967540 | |
67 | Ubiquitination | DDADTGKKKKKTRGD CCCCCCCCCCCCCCC | 71.78 | 24816145 | |
67 | Acetylation | DDADTGKKKKKTRGD CCCCCCCCCCCCCCC | 71.78 | 25953088 | |
68 | Ubiquitination | DADTGKKKKKTRGDH CCCCCCCCCCCCCCH | 64.09 | 22817900 | |
82 | Ubiquitination | HFKLRFRKNFQALLE HHHHHHHHHHHHHHH | 60.44 | 24816145 | |
103 | Phosphorylation | AEGPNYLTACAGPPS HCCCCCEEECCCCCC | 14.88 | 22817900 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZNHI1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZNHI1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
H2AZ_HUMAN | H2AFZ | physical | 20473270 | |
ARP6_HUMAN | ACTR6 | physical | 20473270 | |
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
ACL6A_HUMAN | ACTL6A | physical | 28561026 | |
ARP6_HUMAN | ACTR6 | physical | 28561026 | |
DMAP1_HUMAN | DMAP1 | physical | 28561026 | |
RUVB1_HUMAN | RUVBL1 | physical | 28561026 | |
RUVB2_HUMAN | RUVBL2 | physical | 28561026 | |
SRCAP_HUMAN | SRCAP | physical | 28561026 | |
VPS72_HUMAN | VPS72 | physical | 28561026 | |
YETS4_HUMAN | YEATS4 | physical | 28561026 | |
ZNHI1_HUMAN | ZNHIT1 | physical | 28561026 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A new p38 MAP kinase-regulated transcriptional coactivator thatstimulates p53-dependent apoptosis."; Cuadrado A., Lafarga V., Cheung P.C., Dolado I., Llanos S., Cohen P.,Nebreda A.R.; EMBO J. 26:2115-2126(2007). Cited for: INTERACTION WITH MAPK11 AND MAPK14, PHOSPHORYLATION AT THR-103 BYMAPK11 AND MAPK14, INDUCTION BY DNA DAMAGE, FUNCTION, AND MUTAGENESISOF THR-103. |