MO4L1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MO4L1_MOUSE
• UniProt AC: P60762
• Protein Name: Mortality factor 4-like protein 1
• Gene Name: Morf4l1
• Organism: Mus musculus (Mouse).
• Sequence Length: 362
• Subcellular Localization: Nucleus .
• Protein Description: Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci (By similarity)..
• Protein Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTREDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Ubiquitination	KCVKVAIKDKQVKYF EEEEEEECCCEEEEE	49.49	-
103	Ubiquitination	VPESRVLKYVDTNLQ CCHHHHHHHHHHHHH	40.13	22790023
111	Ubiquitination	YVDTNLQKQRELQKA HHHHHHHHHHHHHHH	55.26	22790023
117	Ubiquitination	QKQRELQKANQEQYA HHHHHHHHHHHHHHH	63.03	22790023
127	Ubiquitination	QEQYAEGKMRGAAPG HHHHHHHHCCCCCCC	19.54	22790023
138	Phosphorylation	AAPGKKTSGLQQKNV CCCCCCCCCCHHCCC	46.52	22817900
143	Acetylation	KTSGLQQKNVEVKTK CCCCCHHCCCEEEEC	50.42	-
143	Ubiquitination	KTSGLQQKNVEVKTK CCCCCHHCCCEEEEC	50.42	22790023
164	Phosphorylation	PGNGDGGSTSETPQP CCCCCCCCCCCCCCC	34.00	19854140
168	Phosphorylation	DGGSTSETPQPPRKK CCCCCCCCCCCCCCC	27.30	19854140
188	Phosphorylation	PTVENEETFMNRVEV CCCCCHHHHHHCEEE	23.23	29899451
198	Ubiquitination	NRVEVKVKIPEELKP HCEEEEEECCHHHCC	46.99	-
226	Ubiquitination	QLFYLPAKKNVDSIL HHEECCCCCCHHHHH	42.83	22790023
227	Ubiquitination	LFYLPAKKNVDSILE HEECCCCCCHHHHHH	65.39	22790023
240	Ubiquitination	LEDYANYKKSRGNTD HHHHHHHHHHCCCCC	44.04	22790023
249	Ubiquitination	SRGNTDNKEYAVNEV HCCCCCCHHHHHHHH	55.71	22790023
336	Phosphorylation	YLHDFLKYLAKNSAT HHHHHHHHHHHCCCC	17.65	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MO4L1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MO4L1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MO4L1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PROF2_HUMAN	PFN2	physical	12391155
SIN3A_HUMAN	SIN3A	physical	12391155
TLE1_HUMAN	TLE1	physical	12391155
KDM5B_MOUSE	Kdm5b	physical	21448134
MOFA1_HUMAN	MRFAP1	physical	15367658
PHF12_MOUSE	Phf12	physical	21041482
HDAC1_MOUSE	Hdac1	physical	21041482
SIN3B_MOUSE	Sin3b	physical	21041482
H2B2E_MOUSE	Hist2h2be	physical	21706008
UBC_MOUSE	Ubc	physical	21706008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.