UniProt ID | MO4L1_MOUSE | |
---|---|---|
UniProt AC | P60762 | |
Protein Name | Mortality factor 4-like protein 1 | |
Gene Name | Morf4l1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 362 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci (By similarity).. | |
Protein Sequence | MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTREDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Ubiquitination | KCVKVAIKDKQVKYF EEEEEEECCCEEEEE | 49.49 | - | |
103 | Ubiquitination | VPESRVLKYVDTNLQ CCHHHHHHHHHHHHH | 40.13 | 22790023 | |
111 | Ubiquitination | YVDTNLQKQRELQKA HHHHHHHHHHHHHHH | 55.26 | 22790023 | |
117 | Ubiquitination | QKQRELQKANQEQYA HHHHHHHHHHHHHHH | 63.03 | 22790023 | |
127 | Ubiquitination | QEQYAEGKMRGAAPG HHHHHHHHCCCCCCC | 19.54 | 22790023 | |
138 | Phosphorylation | AAPGKKTSGLQQKNV CCCCCCCCCCHHCCC | 46.52 | 22817900 | |
143 | Acetylation | KTSGLQQKNVEVKTK CCCCCHHCCCEEEEC | 50.42 | - | |
143 | Ubiquitination | KTSGLQQKNVEVKTK CCCCCHHCCCEEEEC | 50.42 | 22790023 | |
164 | Phosphorylation | PGNGDGGSTSETPQP CCCCCCCCCCCCCCC | 34.00 | 19854140 | |
168 | Phosphorylation | DGGSTSETPQPPRKK CCCCCCCCCCCCCCC | 27.30 | 19854140 | |
188 | Phosphorylation | PTVENEETFMNRVEV CCCCCHHHHHHCEEE | 23.23 | 29899451 | |
198 | Ubiquitination | NRVEVKVKIPEELKP HCEEEEEECCHHHCC | 46.99 | - | |
226 | Ubiquitination | QLFYLPAKKNVDSIL HHEECCCCCCHHHHH | 42.83 | 22790023 | |
227 | Ubiquitination | LFYLPAKKNVDSILE HEECCCCCCHHHHHH | 65.39 | 22790023 | |
240 | Ubiquitination | LEDYANYKKSRGNTD HHHHHHHHHHCCCCC | 44.04 | 22790023 | |
249 | Ubiquitination | SRGNTDNKEYAVNEV HCCCCCCHHHHHHHH | 55.71 | 22790023 | |
336 | Phosphorylation | YLHDFLKYLAKNSAT HHHHHHHHHHHCCCC | 17.65 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MO4L1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MO4L1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MO4L1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PROF2_HUMAN | PFN2 | physical | 12391155 | |
SIN3A_HUMAN | SIN3A | physical | 12391155 | |
TLE1_HUMAN | TLE1 | physical | 12391155 | |
KDM5B_MOUSE | Kdm5b | physical | 21448134 | |
MOFA1_HUMAN | MRFAP1 | physical | 15367658 | |
PHF12_MOUSE | Phf12 | physical | 21041482 | |
HDAC1_MOUSE | Hdac1 | physical | 21041482 | |
SIN3B_MOUSE | Sin3b | physical | 21041482 | |
H2B2E_MOUSE | Hist2h2be | physical | 21706008 | |
UBC_MOUSE | Ubc | physical | 21706008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...