RBBP4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RBBP4_MOUSE
• UniProt AC: Q60972
• Protein Name: Histone-binding protein RBBP4
• Gene Name: Rbbp4
• Organism: Mus musculus (Mouse).
• Sequence Length: 425
• Subcellular Localization: Nucleus.
• Protein Description: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex (By similarity)..
• Protein Sequence: MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADKEAAFD ------CCCHHHHHC	36.26	16452087
4	Acetylation	----MADKEAAFDDA ----CCCHHHHHCHH	39.45	23806337
22	Acetylation	RVINEEYKIWKKNTP HHHCHHHHHHHCCCH	45.42	23806337
26	Ubiquitination	EEYKIWKKNTPFLYD HHHHHHHCCCHHHHH	51.57	-
110	Phosphorylation	GEFGGFGSVSGKIEI CCCCCCCCCCCEEEE	15.73	28833060
112	Phosphorylation	FGGFGSVSGKIEIEI CCCCCCCCCEEEEEE	35.75	28066266
138	Glutathionylation	RYMPQNPCIIATKTP EECCCCCEEEEECCC	4.63	24333276
142	Phosphorylation	QNPCIIATKTPSSDV CCCEEEEECCCCCCE	25.66	26745281
144	Phosphorylation	PCIIATKTPSSDVLV CEEEEECCCCCCEEE	24.85	26745281
146	Phosphorylation	IIATKTPSSDVLVFD EEEECCCCCCEEEEE	44.39	28833060
147	Phosphorylation	IATKTPSSDVLVFDY EEECCCCCCEEEEEC	32.70	26745281
154	Phosphorylation	SDVLVFDYTKHPSKP CCEEEEECCCCCCCC	13.26	25777480
155	Phosphorylation	DVLVFDYTKHPSKPD CEEEEECCCCCCCCC	25.40	25777480
156	Acetylation	VLVFDYTKHPSKPDP EEEEECCCCCCCCCC	47.49	22826441
159	Phosphorylation	FDYTKHPSKPDPSGE EECCCCCCCCCCCCC	57.44	22871156
160	Acetylation	DYTKHPSKPDPSGEC ECCCCCCCCCCCCCC	58.87	23806337
164	Phosphorylation	HPSKPDPSGECNPDL CCCCCCCCCCCCCCC	55.38	22871156
167	Glutathionylation	KPDPSGECNPDLRLR CCCCCCCCCCCCCCC	11.62	24333276
257	Phosphorylation	QKLMIWDTRSNNTSK CEEEEEECCCCCCCC	22.47	22006019
348	Phosphorylation	RLNVWDLSKIGEEQS CCCEEEHHHCCCCCC	21.54	27600695
355	Phosphorylation	SKIGEEQSPEDAEDG HHCCCCCCHHHCCCC	33.27	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RBBP4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RBBP4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RBBP4_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RBBP4_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.