NPM2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NPM2_MOUSE
• UniProt AC: Q80W85
• Protein Name: Nucleoplasmin-2
• Gene Name: Npm2
• Organism: Mus musculus (Mouse).
• Sequence Length: 207
• Subcellular Localization: Nucleus . Found in the oocyte nucleus before nuclear membrane breakdown, after which it is redistributed to the cytoplasm.
• Protein Description: Core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. Probably involved in sperm DNA decondensation during fertilization..
• Protein Sequence: MSRHSTSSVTETTAKNMLWGSELNQEKQTCTFRGQGEKKDSCKLLLSTICLGEKAKEEVNRVEVLSQEGRKPPITIATLKASVLPMVTVSGIELSPPVTFRLRTGSGPVFLSGLECYETSDLTWEDDEEEEEEEEEEDEDEDADISLEEIPVKQVKRVAPQKQMSIAKKKKVEKEEDETVVRPSPQDKSPWKKEKSTPRAKKPVTKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
179	Phosphorylation	VEKEEDETVVRPSPQ CCCCCCCCCCCCCCC	36.30	23375375
184	Phosphorylation	DETVVRPSPQDKSPW CCCCCCCCCCCCCCC	25.32	23375375
195	Acetylation	KSPWKKEKSTPRAKK CCCCCCCCCCCCCCC	69.39	7610071

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NPM2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NPM2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NPM2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NPM2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.