YAF2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YAF2_MOUSE
• UniProt AC: Q99LW6
• Protein Name: YY1-associated factor 2
• Gene Name: Yaf2
• Organism: Mus musculus (Mouse).
• Sequence Length: 179
• Subcellular Localization: Nucleus .
• Protein Description: Binds to MYC and inhibits MYC-mediated transactivation. Also binds to MYCN and enhances MYCN-dependent transcriptional activation. Increases calpain 2-mediated proteolysis of YY1 in vitro. Component of the E2F6.com-1 complex, a repressive complex that methylates 'Lys-9' of histone H3, suggesting that it is involved in chromatin-remodeling..
• Protein Sequence: MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDRVEKDKSEKEAASKKNCHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGEASSLNGESH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MGDKKSPTRPKRQ --CCCCCCCCCCCCC	36.93	29895711
8	Phosphorylation	MGDKKSPTRPKRQPK CCCCCCCCCCCCCCC	67.69	28066266
57	Phosphorylation	TRKPRPVSQLVAQQV CCCCCCHHHHHHHHH	22.08	-
87	Phosphorylation	DRVEKDKSEKEAASK HHHHHCHHHHHHHHH	65.12	20531401
136	Phosphorylation	DFKEKAKSAPASSAA CHHHHHHHCCCCCCC	44.32	30635358
140	Phosphorylation	KAKSAPASSAAGDQH HHHHCCCCCCCCCCC	21.32	23984901
141	Phosphorylation	AKSAPASSAAGDQHS HHHCCCCCCCCCCCC	25.01	23984901
148	Phosphorylation	SAAGDQHSQGSCSSD CCCCCCCCCCCCCCC	30.51	26160508
151	Phosphorylation	GDQHSQGSCSSDSTE CCCCCCCCCCCCCCC	11.82	26160508
153	Phosphorylation	QHSQGSCSSDSTERG CCCCCCCCCCCCCCC	38.59	26160508
154	Phosphorylation	HSQGSCSSDSTERGV CCCCCCCCCCCCCCC	39.65	27087446
156	Phosphorylation	QGSCSSDSTERGVSR CCCCCCCCCCCCCCC	33.83	26160508
157	Phosphorylation	GSCSSDSTERGVSRS CCCCCCCCCCCCCCC	34.39	26160508
162	Phosphorylation	DSTERGVSRSSSPRG CCCCCCCCCCCCCCC	29.30	26160508
164	Phosphorylation	TERGVSRSSSPRGEA CCCCCCCCCCCCCCH	27.88	27087446
165	Phosphorylation	ERGVSRSSSPRGEAS CCCCCCCCCCCCCHH	43.16	22802335
166	Phosphorylation	RGVSRSSSPRGEASS CCCCCCCCCCCCHHH	21.62	27087446
172	Phosphorylation	SSPRGEASSLNGESH CCCCCCHHHCCCCCC	30.93	27087446
173	Phosphorylation	SPRGEASSLNGESH- CCCCCHHHCCCCCC-	32.66	21082442
178	Phosphorylation	ASSLNGESH------ HHHCCCCCC------	35.58	21743459

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
166	S	Phosphorylation	Kinase	GSK3A	Q2NL51	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YAF2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YAF2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of YAF2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.