dbPTM

PCGF5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PCGF5_MOUSE
UniProt AC	Q3UK78
Protein Name	Polycomb group RING finger protein 5
Gene Name	Pcgf5
Organism	Mus musculus (Mouse).
Sequence Length	256
Subcellular Localization	Nucleus . Nucleus, nucleoplasm . Recruited by the non-coding RNA Xist to specific nuclear foci that probably correspond to the inactivated X chromosome.
Protein Description	Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. [PubMed: 27136092]
Protein Sequence	MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELQRELEFWKKNKPQENGQDDISKVDKSKADEEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENLCCLNCSASQVCSQDGTLYQSYPMVLQYRPRIDFG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	TCYICKGYLIKPTTV EEEEECCEEECCEEH	7.25	20139300
29	Phosphorylation	KGYLIKPTTVTECLH CCEEECCEEHHHHHH	28.97	20139300
30	Phosphorylation	GYLIKPTTVTECLHT CEEECCEEHHHHHHH	33.68	20139300
37	Phosphorylation	TVTECLHTFCKTCIV EHHHHHHHHHHHHHH	20.13	20139300

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PCGF5_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PCGF5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PCGF5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PCGF5_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PCGF5_MOUSE

Related Literatures of Post-Translational Modification