| UniProt ID | CBX1_MOUSE | |
|---|---|---|
| UniProt AC | P83917 | |
| Protein Name | Chromobox protein homolog 1 | |
| Gene Name | Cbx1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 185 | |
| Subcellular Localization | Nucleus. Unassociated with chromosomes during mitosis.. | |
| Protein Description | Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.. | |
| Protein Sequence | MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Acetylation | MGKKQNKKKVEEVLE CCCCCCHHHHHHHHH | 70.38 | 22826441 | |
| 9 | Acetylation | GKKQNKKKVEEVLEE CCCCCHHHHHHHHHH | 57.39 | 21728379 | |
| 43 | Ubiquitination | VEYLLKWKGFSDEDN CEEEEEECCCCCCCC | 48.79 | - | |
| 51 | Phosphorylation | GFSDEDNTWEPEENL CCCCCCCCCCCHHCC | 43.45 | 26239621 | |
| 84 | Acetylation | TDKSEGGKRKADSDS CCCCCCCCCCCCCCC | 62.68 | 129781 | |
| 89 | Phosphorylation | GGKRKADSDSEDKGE CCCCCCCCCCCCCCC | 48.14 | 27087446 | |
| 91 | Phosphorylation | KRKADSDSEDKGEES CCCCCCCCCCCCCCC | 52.20 | 23684622 | |
| 98 | Phosphorylation | SEDKGEESKPKKKKE CCCCCCCCCCCHHHH | 50.37 | 25159016 | |
| 107 | Phosphorylation | PKKKKEESEKPRGFA CCHHHHHCCCCCCCC | 52.60 | 23737553 | |
| 126 | Phosphorylation | PERIIGATDSSGELM HHHEEEEECCCCCEE | 31.07 | 26643407 | |
| 128 | Phosphorylation | RIIGATDSSGELMFL HEEEEECCCCCEEEE | 35.57 | 28833060 | |
| 129 | Phosphorylation | IIGATDSSGELMFLM EEEEECCCCCEEEEE | 38.81 | 24068923 | |
| 139 | Ubiquitination | LMFLMKWKNSDEADL EEEEEEECCCCHHCC | 40.84 | 27667366 | |
| 141 | Phosphorylation | FLMKWKNSDEADLVP EEEEECCCCHHCCCC | 32.85 | 22802335 | |
| 150 | Ubiquitination | EADLVPAKEANVKCP HHCCCCHHHHCCCCC | 51.82 | 27667366 | |
| 169 | Phosphorylation | SFYEERLTWHSYPSE EEEHHHHCCCCCCCC | 27.61 | 28066266 | |
| 172 | Phosphorylation | EERLTWHSYPSEDDD HHHHCCCCCCCCCCC | 30.24 | 23737553 | |
| 173 | Phosphorylation | ERLTWHSYPSEDDDK HHHCCCCCCCCCCCC | 9.63 | 28066266 | |
| 175 | Phosphorylation | LTWHSYPSEDDDKKD HCCCCCCCCCCCCCC | 45.48 | 23737553 | |
| 180 | Ubiquitination | YPSEDDDKKDDKN-- CCCCCCCCCCCCC-- | 66.16 | - | |
| 181 | Ubiquitination | PSEDDDKKDDKN--- CCCCCCCCCCCC--- | 77.48 | - | |
| 184 | Ubiquitination | DDDKKDDKN------ CCCCCCCCC------ | 74.76 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CBX1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBX1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBX1_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
