UniProt ID | KC1AL_HUMAN | |
---|---|---|
UniProt AC | Q8N752 | |
Protein Name | Casein kinase I isoform alpha-like | |
Gene Name | CSNK1A1L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 337 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By similarity).. | |
Protein Sequence | MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Acetylation | MTNNSGSKAELVVGG CCCCCCCCEEEEECC | 49.78 | - | |
53 | Acetylation | KLESQKVKHPQLLYE EECCCCCCCCHHHHH | 57.51 | 7966147 | |
59 | Phosphorylation | VKHPQLLYESKLYTI CCCCHHHHHHHHHHH | 27.09 | 28331001 | |
62 | Acetylation | PQLLYESKLYTILQG CHHHHHHHHHHHHCC | 33.31 | 7966155 | |
83 | Acetylation | MHWYGQEKDNNVLVM CCCCCCCCCCCEEEE | 58.84 | 7966163 | |
105 | Phosphorylation | EDLFNFCSRRFTMKT HHHHHHHHHCCCHHH | 23.50 | 19690332 | |
109 | Phosphorylation | NFCSRRFTMKTVLML HHHHHCCCHHHHHHH | 18.88 | 22210691 | |
126 | Phosphorylation | QMISRIEYVHTKNFL HHHHHCEEEECCCCC | 8.65 | 28102081 | |
130 | Ubiquitination | RIEYVHTKNFLHRDI HCEEEECCCCCCCCC | 30.72 | 21890473 | |
146 | Phosphorylation | PDNFLMGTGRHCNKL CCCEECCCCCCCCEE | 19.65 | - | |
152 | Ubiquitination | GTGRHCNKLFLIDFG CCCCCCCEEEEECHH | 46.11 | 33845483 | |
162 | Ubiquitination | LIDFGLAKKYRDNRT EECHHCCHHHCCCCC | 56.21 | 21906983 | |
184 | Phosphorylation | EDKHLIGTVRYASIN CCCCCCEEEEHHHHH | 8.53 | - | |
199 | Phosphorylation | AHLGIEQSRRDDMES HHCCCCHHHHHHHHH | 19.25 | - | |
206 | Phosphorylation | SRRDDMESLGYVFMY HHHHHHHHHCEEEHE | 22.06 | - | |
209 | Phosphorylation | DDMESLGYVFMYFNR HHHHHHCEEEHEECC | 8.87 | - | |
213 | Phosphorylation | SLGYVFMYFNRTSLP HHCEEEHEECCCCCC | 6.04 | - | |
228 | Phosphorylation | WQGLRAMTKKQKYEK HHHHHHHHHHHHHHH | 33.82 | 21406692 | |
240 | Ubiquitination | YEKISEKKMSTPVEV HHHHCCCCCCCCHHH | 33.75 | - | |
242 | Phosphorylation | KISEKKMSTPVEVLC HHCCCCCCCCHHHHC | 38.14 | 19860830 | |
287 | Phosphorylation | LFRILFRTLNHQYDY HHHHHHHHCCCCCCC | 25.28 | 26356563 | |
292 | Phosphorylation | FRTLNHQYDYTFDWT HHHCCCCCCCCCCHH | 11.90 | 26356563 | |
294 | Phosphorylation | TLNHQYDYTFDWTML HCCCCCCCCCCHHHH | 12.36 | 26356563 | |
295 | Phosphorylation | LNHQYDYTFDWTMLK CCCCCCCCCCHHHHH | 16.54 | 26356563 | |
299 | Phosphorylation | YDYTFDWTMLKQKAA CCCCCCHHHHHHHHH | 17.92 | 26356563 | |
302 | Ubiquitination | TFDWTMLKQKAAQQA CCCHHHHHHHHHHHH | 38.64 | 21906983 | |
304 | Ubiquitination | DWTMLKQKAAQQAAS CHHHHHHHHHHHHHH | 44.07 | 33845483 | |
311 | Phosphorylation | KAAQQAASSSGQGQQ HHHHHHHHHCCCCHH | 28.22 | 18691976 | |
312 | Phosphorylation | AAQQAASSSGQGQQA HHHHHHHHCCCCHHH | 33.49 | 18691976 | |
313 | Phosphorylation | AQQAASSSGQGQQAQ HHHHHHHCCCCHHHH | 32.42 | 19413330 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KC1AL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KC1AL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KC1AL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JAM2_HUMAN | JAM2 | physical | 21988832 | |
TNR1B_HUMAN | TNFRSF1B | physical | 8051045 | |
KC1AL_HUMAN | CSNK1A1L | physical | 8051045 | |
TNR1A_HUMAN | TNFRSF1A | physical | 8051045 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...