| UniProt ID | YJ133_YEAST | |
|---|---|---|
| UniProt AC | Q3E7A3 | |
| Protein Name | Uncharacterized protein YJL133C-A | |
| Gene Name | YJL133C-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 74 | |
| Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MIAQSTRLAAAVSSSAASAGVSRIAASAMASTIFKRSPGNSFNSFKEYRENAKTYGPLSASLATRRHLAHAPKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Phosphorylation | TRLAAAVSSSAASAG HHHHHHHHHHHHHHC | 17.53 | 29136822 | |
| 14 | Phosphorylation | RLAAAVSSSAASAGV HHHHHHHHHHHHHCH | 19.87 | 29136822 | |
| 15 | Phosphorylation | LAAAVSSSAASAGVS HHHHHHHHHHHHCHH | 21.98 | 29136822 | |
| 41 | Phosphorylation | FKRSPGNSFNSFKEY HHCCCCCCCHHHHHH | 31.55 | 30377154 | |
| 44 | Phosphorylation | SPGNSFNSFKEYREN CCCCCCHHHHHHHHH | 35.37 | 30377154 | |
| 54 | Phosphorylation | EYRENAKTYGPLSAS HHHHHHHHHCCCHHH | 31.16 | 22369663 | |
| 55 | Phosphorylation | YRENAKTYGPLSASL HHHHHHHHCCCHHHH | 18.95 | 22369663 | |
| 59 | Phosphorylation | AKTYGPLSASLATRR HHHHCCCHHHHHHHH | 20.95 | 22369663 | |
| 61 | Phosphorylation | TYGPLSASLATRRHL HHCCCHHHHHHHHHH | 18.37 | 22369663 | |
| 64 | Phosphorylation | PLSASLATRRHLAHA CCHHHHHHHHHHHCC | 33.26 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJ133_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJ133_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJ133_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
