UniProt ID | RTX2_SCHPO | |
---|---|---|
UniProt AC | O94355 | |
Protein Name | Transcriptional regulatory protein rxt2 | |
Gene Name | rtx2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 240 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the RPD3C(L) histone deacetylase complex (HDAC) responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events (By similarity).. | |
Protein Sequence | MKQFEEQIERFKQALFEDSDASDSDSSIGEALTNRGLKRKKGSKNVYYGCVGNSSGSSIDIDYYNIGNTKRGVVSHFRRRIDPEWLDHDNPYNDINIAEIMSPLTKPQDLLTHPAISSIFEQNYLSILASSALEIISAEHKYTAHLEQLMVALLGDDPSLPGPPHEVFGISPEQCRELTITVQEALEKSKEFIRCWTNVRMDLLRAIRFKNKVIAYCQGEDYNGNTQVLSKNESDGKPNS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | KQALFEDSDASDSDS HHHHHCCCCCCCCCC | 28.07 | 21712547 | |
22 | Phosphorylation | LFEDSDASDSDSSIG HHCCCCCCCCCCHHH | 42.51 | 21712547 | |
24 | Phosphorylation | EDSDASDSDSSIGEA CCCCCCCCCCHHHHH | 36.58 | 21712547 | |
27 | Phosphorylation | DASDSDSSIGEALTN CCCCCCCHHHHHHHH | 39.33 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RTX2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RTX2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RTX2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...