dbPTM

SPT3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SPT3_SCHPO
UniProt AC	O14311
Protein Name	SAGA complex subunit spt3
Gene Name	spt3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	307
Subcellular Localization	Nucleus .
Protein Description	Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. SAGA is involved in RNA polymerase II-dependent transcriptional regulation. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (spt3, spt8 and spt20) and promoter selectivity, interaction with transcription activators (gcn5, ada2, ada3 and tra1), and chromatin modification through histone acetylation (gcn5) and deubiquitination (ubp8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Spt3 is required for recruitment of TATA-binding protein (TBP) to SAGA-dependent promoters. During SAGA-mediated transcriptional inhibition, spt3 and spt8 prevent binding of TBP to the TATA box (By similarity). SPT factors 3, 7 and 8 are required for the initiation of Ty transcription from the delta promoter. Spt3 regulates Ty1 as well as the mating factor genes..
Protein Sequence	MTETGRTSKYRVEIQQMMFILGEVQDPLPETTQLVEELIRGQVMEMLIQANELALRRGSRSITVEDLFFLIRHDRAKVNRLKTYLSWKEVRKKAKEQDANPADTKDLFEEVDSKTRSMNAVAMPWEVKNMFTEPVPETEEFEEDNDTMEMAYATRQRLKMADERTKKMTREEYVHWSECRQASFTYRKGKRFREWCGMSILTDTRPDNDIVDILGFLTFEIVATLTEEALAVKDRMDRIQNSSGSGGSHAAHHPKNCSLFDGLTEGRTPLQVSHVLEAFRRLQIPDKTHTAMRSFHGGLVKSRVYLI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SPT3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SPT3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SPT3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SPT3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SPT3_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SPT3_SCHPO

Related Literatures of Post-Translational Modification