YDHG_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YDHG_SCHPO
• UniProt AC: Q92361
• Protein Name: Uncharacterized protein C6G9.16c
• Gene Name: SPAC6G9.16c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 264
• Protein Sequence: MKFFLSLKDFKGEKFVLRSELDESSAFLCAISPTCRYVLRDEIPWKRLQRNVTSESLTDELIVDLLCGRSESKHTLQLVVLENLCRIYINYVDPFPLRIAWFELEQQALKDHEHFDVLWECSHSIKDLALASMAQQKNELQKLMAYTEQLQEECKSRERKLIMKFADMIKNARNNEDNEDNHHINYEDESDVGTDEQKQQEGVNSSAVSDTDESAVSDEFMQIKEEFPMKALSASPTADASPESAGEDDSHRRSSHESSETVSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
186	Phosphorylation	EDNHHINYEDESDVG CCCCCCCCCCHHCCC	24.93	29996109
190	Phosphorylation	HINYEDESDVGTDEQ CCCCCCHHCCCCHHH	50.33	21712547
235	Phosphorylation	PMKALSASPTADASP CCHHHHCCCCCCCCC	21.29	25720772
241	Phosphorylation	ASPTADASPESAGED CCCCCCCCCCCCCCC	29.73	25720772
244	Phosphorylation	TADASPESAGEDDSH CCCCCCCCCCCCCCC	44.98	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YDHG_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YDHG_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YDHG_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YH7G_SCHPO	SPBC16G5.16	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.