UniProt ID | YDHG_SCHPO | |
---|---|---|
UniProt AC | Q92361 | |
Protein Name | Uncharacterized protein C6G9.16c | |
Gene Name | SPAC6G9.16c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 264 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKFFLSLKDFKGEKFVLRSELDESSAFLCAISPTCRYVLRDEIPWKRLQRNVTSESLTDELIVDLLCGRSESKHTLQLVVLENLCRIYINYVDPFPLRIAWFELEQQALKDHEHFDVLWECSHSIKDLALASMAQQKNELQKLMAYTEQLQEECKSRERKLIMKFADMIKNARNNEDNEDNHHINYEDESDVGTDEQKQQEGVNSSAVSDTDESAVSDEFMQIKEEFPMKALSASPTADASPESAGEDDSHRRSSHESSETVSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
186 | Phosphorylation | EDNHHINYEDESDVG CCCCCCCCCCHHCCC | 24.93 | 29996109 | |
190 | Phosphorylation | HINYEDESDVGTDEQ CCCCCCHHCCCCHHH | 50.33 | 21712547 | |
235 | Phosphorylation | PMKALSASPTADASP CCHHHHCCCCCCCCC | 21.29 | 25720772 | |
241 | Phosphorylation | ASPTADASPESAGED CCCCCCCCCCCCCCC | 29.73 | 25720772 | |
244 | Phosphorylation | TADASPESAGEDDSH CCCCCCCCCCCCCCC | 44.98 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YDHG_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YDHG_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YDHG_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YH7G_SCHPO | SPBC16G5.16 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...