MUG82_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MUG82_SCHPO
• UniProt AC: Q9HDZ3
• Protein Name: Meiotically up-regulated gene 82 protein
• Gene Name: mug82
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 182
• Subcellular Localization: Mitochondrion .
• Protein Description: Has a role in meiosis..
• Protein Sequence: MFANFRNCFKIKNSRLIYDNINKCLLTKEETNQLLKFIHLKWKPAKDQVQISFSRSSGPGGQNVNKLNTKVIVNLPFKQLESCIPMFLINHFKTCEMLRNYRIQNGIKIYSQKTRSQHKNIEDALNKISDLLNKSAETLYVPDTPPEKIARISILKKESNEKRLSEKKYKQKKKTQRRITMD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MUG82_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MUG82_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MUG82_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MUG82_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YONI_SCHPO	pth3	genetic	23892058
RM03_HUMAN	MRPL3	physical	23892058
RM12_HUMAN	MRPL12	physical	23892058
RT29_HUMAN	DAP3	physical	23892058
RT18B_HUMAN	MRPS18B	physical	23892058

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.