dbPTM

OTU1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OTU1_SCHPO
UniProt AC	O13974
Protein Name	Putative ubiquitin thioesterase otu1
Gene Name	otu1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	329
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Hydrolase that can remove conjugated ubiquitin from proteins and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (By similarity). Has a role in meiosis..
Protein Sequence	MSSLRLRLKYENQSAVETVEANATVGSFLDLVAAKFSLPRNSIALKFGFPPQDIPLVNSDVPLSTLVSSGQQILVLKNAATSFSTNEPAKPPIPNAATKPTFPPQTEISNPPAVSHQSKNTSQDPPYVSTPIGDIALRVMPDDNSCLFRALSKPLGFSPYELREIVANQVLSNPDIYSTAILGKPSIEYASWIRKETSWGGYIELSILSSHFGVEICSVDVKTGRVDSYNPQPATGQRTYIVYSGIHYDLAALAAVLWDTDVDVVLFDASDVTITPYVQQLASLLKNMHYYTDTASFSIRCTICGTGLVGEKDATAHALATGHTQFGEY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of OTU1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OTU1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OTU1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OTU1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC48_SCHPO	cdc48	physical	20838651
UBX3_SCHPO	ubx3	physical	23695164
CSH3_SCHPO	SPBC119.05c	physical	23695164
UBX3_SCHPO	ubx3	physical	26771498
RL31_SCHPO	rpl31	physical	26771498
CSH3_SCHPO	SPBC119.05c	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OTU1_SCHPO

Related Literatures of Post-Translational Modification