UniProt ID | FOXB1_HUMAN | |
---|---|---|
UniProt AC | Q99853 | |
Protein Name | Forkhead box protein B1 | |
Gene Name | FOXB1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 325 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | YSDQKPPYSYISLTA CCCCCCCCCEEEHHH | 23.72 | - | |
18 | Phosphorylation | DQKPPYSYISLTAMA CCCCCCCEEEHHHHH | 6.67 | - | |
40 | Phosphorylation | MLPLSEIYKFIMDRF HCCHHHHHHHHHHHC | 8.87 | 22817900 | |
121 | Acetylation | SDHLAPSKPADAAQY CCCCCCCCHHHHHHH | 43.07 | 26051181 | |
321 | Phosphorylation | SPASALHSVAVH--- CCHHHHHHHCCC--- | 16.78 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FOXB1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOXB1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOXB1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...