| UniProt ID | AN32C_HUMAN | |
|---|---|---|
| UniProt AC | O43423 | |
| Protein Name | Acidic leucine-rich nuclear phosphoprotein 32 family member C | |
| Gene Name | ANP32C | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 234 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 | Phosphorylation | LALDNSRSNEGKLEA HHHCCCCCCCHHHHH | 38.77 | 23663014 | |
| 55 | Phosphorylation | SKINGGLTSISDLPK HHHCCCCCCHHHCCC | 27.56 | 21406692 | |
| 56 | Phosphorylation | KINGGLTSISDLPKL HHCCCCCCHHHCCCC | 25.74 | 21406692 | |
| 58 | Phosphorylation | NGGLTSISDLPKLKL CCCCCCHHHCCCCCC | 32.63 | 23403867 | |
| 73 | Phosphorylation | RKLELRVSGGLEVLA CEEEEEECCHHHHHH | 22.25 | 21815630 | |
| 82 | Acetylation | GLEVLAEKCPNLTHL HHHHHHHHCCCCCEE | 49.76 | 26051181 | |
| 87 | Phosphorylation | AEKCPNLTHLYLSGN HHHCCCCCEEEECCC | 19.24 | 50565687 | |
| 97 | Acetylation | YLSGNKIKDLSTIEP EECCCCCCCCCCCHH | 54.98 | 26051181 | |
| 97 | Ubiquitination | YLSGNKIKDLSTIEP EECCCCCCCCCCCHH | 54.98 | 32015554 | |
| 100 | Phosphorylation | GNKIKDLSTIEPLKQ CCCCCCCCCCHHHHH | 37.16 | 54887293 | |
| 101 | Phosphorylation | NKIKDLSTIEPLKQL CCCCCCCCCHHHHHH | 36.34 | 28857561 | |
| 139 | Phosphorylation | FKLLLQLTYLDSCYW HHHHHHHHHHHHCCC | 14.74 | 25690035 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AN32C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AN32C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AN32C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of AN32C_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...