UniProt ID | AN32C_HUMAN | |
---|---|---|
UniProt AC | O43423 | |
Protein Name | Acidic leucine-rich nuclear phosphoprotein 32 family member C | |
Gene Name | ANP32C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 234 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Phosphorylation | LALDNSRSNEGKLEA HHHCCCCCCCHHHHH | 38.77 | 23663014 | |
55 | Phosphorylation | SKINGGLTSISDLPK HHHCCCCCCHHHCCC | 27.56 | 21406692 | |
56 | Phosphorylation | KINGGLTSISDLPKL HHCCCCCCHHHCCCC | 25.74 | 21406692 | |
58 | Phosphorylation | NGGLTSISDLPKLKL CCCCCCHHHCCCCCC | 32.63 | 23403867 | |
73 | Phosphorylation | RKLELRVSGGLEVLA CEEEEEECCHHHHHH | 22.25 | 21815630 | |
82 | Acetylation | GLEVLAEKCPNLTHL HHHHHHHHCCCCCEE | 49.76 | 26051181 | |
87 | Phosphorylation | AEKCPNLTHLYLSGN HHHCCCCCEEEECCC | 19.24 | 50565687 | |
97 | Acetylation | YLSGNKIKDLSTIEP EECCCCCCCCCCCHH | 54.98 | 26051181 | |
97 | Ubiquitination | YLSGNKIKDLSTIEP EECCCCCCCCCCCHH | 54.98 | 32015554 | |
100 | Phosphorylation | GNKIKDLSTIEPLKQ CCCCCCCCCCHHHHH | 37.16 | 54887293 | |
101 | Phosphorylation | NKIKDLSTIEPLKQL CCCCCCCCCHHHHHH | 36.34 | 28857561 | |
139 | Phosphorylation | FKLLLQLTYLDSCYW HHHHHHHHHHHHCCC | 14.74 | 25690035 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AN32C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AN32C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AN32C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AN32C_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...