| UniProt ID | LEG8_HUMAN | |
|---|---|---|
| UniProt AC | O00214 | |
| Protein Name | Galectin-8 {ECO:0000303|Ref.2} | |
| Gene Name | LGALS8 {ECO:0000312|HGNC:HGNC:6569} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 317 | |
| Subcellular Localization | Cytoplasmic vesicle . Cytoplasm, cytosol . | |
| Protein Description | Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. [PubMed: 22246324] | |
| Protein Sequence | MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MMLSLNNLQNI ----CCCCCCCCCHH | 15.91 | 24043423 | |
| 13 | Phosphorylation | NNLQNIIYNPVIPFV CCCCHHHCCCCCCCC | 15.04 | 24043423 | |
| 22 | Phosphorylation | PVIPFVGTIPDQLDP CCCCCCCCCCCCCCC | 24.84 | 24043423 | |
| 31 | Phosphorylation | PDQLDPGTLIVIRGH CCCCCCCCEEEEECC | 20.78 | 24043423 | |
| 54 | Phosphorylation | QVDLQNGSSMKPRAD EEECCCCCCCCCCCE | 34.51 | - | |
| 55 | Phosphorylation | VDLQNGSSMKPRADV EECCCCCCCCCCCEE | 32.02 | - | |
| 57 | Ubiquitination | LQNGSSMKPRADVAF CCCCCCCCCCCEEEE | 33.04 | 21890473 | |
| 85 | Ubiquitination | CNTLINEKWGREEIT ECCCCCCCCCCCCCC | 50.92 | 32015554 | |
| 97 (in isoform 1) | Ubiquitination | - | 14.65 | 21890473 | |
| 98 (in isoform 2) | Ubiquitination | - | 61.93 | 21890473 | |
| 98 | Ubiquitination | ITYDTPFKREKSFEI CCCCCCCCCCCCEEE | 61.93 | 21890473 | |
| 98 | Ubiquitination | ITYDTPFKREKSFEI CCCCCCCCCCCCEEE | 61.93 | 983 | |
| 98 | Ubiquitination | ITYDTPFKREKSFEI CCCCCCCCCCCCEEE | 61.93 | 21890473 | |
| 98 | Ubiquitination | ITYDTPFKREKSFEI CCCCCCCCCCCCEEE | 61.93 | 21890473 | |
| 111 | Ubiquitination | EIVIMVLKDKFQVAV EEEEEEECCCEEEEE | 47.68 | 33845483 | |
| 134 | Ubiquitination | GHRIGPEKIDTLGIY CEECCHHHCEEEEEE | 49.36 | 29967540 | |
| 141 (in isoform 2) | Phosphorylation | - | 14.75 | 25147952 | |
| 141 | Phosphorylation | KIDTLGIYGKVNIHS HCEEEEEECCEEEEE | 14.75 | 23917254 | |
| 160 | O-linked_Glycosylation | FSSDLQSTQASSLEL CCCCCCCCCCCEEEE | 18.39 | OGP | |
| 171 | Phosphorylation | SLELTEISRENVPKS EEEEEEHHHHHCCCC | 27.58 | 21815630 | |
| 177 | Ubiquitination | ISRENVPKSGTPQLR HHHHHCCCCCCCCCC | 58.18 | 27667366 | |
| 180 (in isoform 2) | Phosphorylation | - | 18.23 | 28674419 | |
| 193 | Ubiquitination | PFAARLNTPMGPGRT CEEEECCCCCCCCCE | 21.17 | 32015554 | |
| 193 (in isoform 2) | Ubiquitination | - | 21.17 | - | |
| 193 | Phosphorylation | PFAARLNTPMGPGRT CEEEECCCCCCCCCE | 21.17 | - | |
| 193 (in isoform 2) | Methylation | - | 21.17 | - | |
| 200 | Phosphorylation | TPMGPGRTVVVKGEV CCCCCCCEEEEEEEE | 24.46 | - | |
| 203 (in isoform 2) | Phosphorylation | - | 5.99 | 25954137 | |
| 204 | Ubiquitination | PGRTVVVKGEVNANA CCCEEEEEEEECCCC | 37.43 | 29967540 | |
| 204 (in isoform 2) | Methylation | - | 37.43 | - | |
| 211 (in isoform 1) | Ubiquitination | - | 13.37 | 21890473 | |
| 212 | Ubiquitination | GEVNANAKSFNVDLL EEECCCCCEECEEEE | 56.22 | 23000965 | |
| 221 (in isoform 1) | Ubiquitination | - | 34.44 | 21890473 | |
| 222 | Ubiquitination | NVDLLAGKSKDIALH CEEEEEECCCEEHHH | 49.04 | 21906983 | |
| 224 | Ubiquitination | DLLAGKSKDIALHLN EEEEECCCEEHHHCC | 57.55 | 23503661 | |
| 236 (in isoform 1) | Ubiquitination | - | 3.94 | 21890473 | |
| 237 | Ubiquitination | LNPRLNIKAFVRNSF CCCCCCHHHHHHCHH | 34.40 | 23000965 | |
| 246 | Ubiquitination | FVRNSFLQESWGEEE HHHCHHHCCCCCCCC | 40.44 | 29967540 | |
| 254 | Ubiquitination | ESWGEEERNITSFPF CCCCCCCCCCCCCCC | 43.03 | 21890473 | |
| 254 (in isoform 2) | Ubiquitination | - | 43.03 | 21890473 | |
| 254 | Ubiquitination | ESWGEEERNITSFPF CCCCCCCCCCCCCCC | 43.03 | 21890473 | |
| 254 | Ubiquitination | ESWGEEERNITSFPF CCCCCCCCCCCCCCC | 43.03 | 21890473 | |
| 254 | Ubiquitination | ESWGEEERNITSFPF CCCCCCCCCCCCCCC | 43.03 | 23000965 | |
| 257 | Phosphorylation | GEEERNITSFPFSPG CCCCCCCCCCCCCCC | 28.06 | 25907765 | |
| 258 | Phosphorylation | EEERNITSFPFSPGM CCCCCCCCCCCCCCC | 27.42 | 25907765 | |
| 262 | Phosphorylation | NITSFPFSPGMYFEM CCCCCCCCCCCEEEE | 22.30 | 25907765 | |
| 264 (in isoform 2) | Ubiquitination | - | 23.40 | 21890473 | |
| 264 | Ubiquitination | TSFPFSPGMYFEMII CCCCCCCCCEEEEEE | 23.40 | 27667366 | |
| 266 (in isoform 2) | Ubiquitination | - | 11.42 | - | |
| 266 | Phosphorylation | FPFSPGMYFEMIIYC CCCCCCCEEEEEEEE | 11.42 | 25907765 | |
| 266 | Ubiquitination | FPFSPGMYFEMIIYC CCCCCCCEEEEEEEE | 11.42 | 23503661 | |
| 272 | Phosphorylation | MYFEMIIYCDVREFK CEEEEEEEEECCEEE | 3.31 | 25907765 | |
| 279 (in isoform 2) | Ubiquitination | - | 25.24 | 21890473 | |
| 279 | Ubiquitination | YCDVREFKVAVNGVH EEECCEEEEEECCCC | 25.24 | 21890473 | |
| 279 | Ubiquitination | YCDVREFKVAVNGVH EEECCEEEEEECCCC | 25.24 | 21890473 | |
| 279 | Ubiquitination | YCDVREFKVAVNGVH EEECCEEEEEECCCC | 25.24 | 21890473 | |
| 279 | Ubiquitination | YCDVREFKVAVNGVH EEECCEEEEEECCCC | 25.24 | 21890473 | |
| 291 | Ubiquitination | GVHSLEYKHRFKELS CCCCCCEEHHCEECC | 20.94 | 29967540 | |
| 333 | Ubiquitination | ----------------------- ----------------------- | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LEG8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEG8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEG8_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
