| UniProt ID | S36A1_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z2H8 | |
| Protein Name | Proton-coupled amino acid transporter 1 | |
| Gene Name | SLC36A1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 476 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . Lysosome membrane Multi-pass membrane protein . In neurons, colocalizes with the exocyst complex in the axonal processes. |
|
| Protein Description | Neutral amino acid/proton symporter. Has a pH-dependent electrogenic transport activity for small amino acids such as glycine, alanine and proline. Besides small apolar L-amino acids, it also recognizes their D-enantiomers and selected amino acid derivatives such as gamma-aminobutyric acid (By similarity).. | |
| Protein Sequence | MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSTQRLRNE ------CCCCCCCCC | 32.99 | 24719451 | |
| 3 | Phosphorylation | -----MSTQRLRNED -----CCCCCCCCCC | 19.19 | 24719451 | |
| 11 | Phosphorylation | QRLRNEDYHDYSSTD CCCCCCCCCCCCCCC | 7.16 | 27642862 | |
| 14 | Phosphorylation | RNEDYHDYSSTDVSP CCCCCCCCCCCCCCC | 7.39 | - | |
| 15 | Phosphorylation | NEDYHDYSSTDVSPE CCCCCCCCCCCCCCC | 32.59 | 27642862 | |
| 34 | Phosphorylation | EGLNNLSSPGSYQRF CCCCCCCCCCCHHHC | 36.12 | 28555341 | |
| 174 | N-linked_Glycosylation | KQVIEAANGTTNNCH HHHHHHHCCCCCCCC | 56.23 | UniProtKB CARBOHYD | |
| 177 | Phosphorylation | IEAANGTTNNCHNNE HHHHCCCCCCCCCCC | 26.32 | 22210691 | |
| 183 | N-linked_Glycosylation | TTNNCHNNETVILTP CCCCCCCCCEEEECC | 23.73 | UniProtKB CARBOHYD | |
| 194 | Phosphorylation | ILTPTMDSRLYMLSF EECCCCCCHHHHHHH | 17.23 | 22210691 | |
| 470 | N-linked_Glycosylation | SNAPIFINSTCAFI- CCCCEEECCCCCCC- | 22.10 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S36A1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S36A1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S36A1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S36A1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
