dbPTM

CD63_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CD63_HUMAN
UniProt AC	P08962
Protein Name	CD63 antigen
Gene Name	CD63
Organism	Homo sapiens (Human).
Sequence Length	238
Subcellular Localization	Cell membrane Multi-pass membrane protein . Lysosome membrane Multi-pass membrane protein . Late endosome membrane Multi-pass membrane protein . Endosome, multivesicular body . Melanosome . Secreted, exosome . Cell surface . Also found in Weibe
Protein Description	Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli..
Protein Sequence	MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
87	Ubiquitination	YCLMITFAIFLSLIM HHHHHHHHHHHHHHH	5.29	21890473
105	Ubiquitination	VAAAIAGYVFRDKVM HHHHHHHHHHHHHHH	6.33	21890473
110	2-Hydroxyisobutyrylation	AGYVFRDKVMSEFNN HHHHHHHHHHHHHHH	35.26	-
110	Ubiquitination	AGYVFRDKVMSEFNN HHHHHHHHHHHHHHH	35.26	21890473
113	Phosphorylation	VFRDKVMSEFNNNFR HHHHHHHHHHHHHHH	41.86	28060719
128	Ubiquitination	QQMENYPKNNHTASI HHHHHCCCCCCHHHH	61.08	21890473
130	N-linked_Glycosylation	MENYPKNNHTASILD HHHCCCCCCHHHHHH	39.76	12754519
139	Ubiquitination	TASILDRMQADFKCC HHHHHHHHHHHHCCC	3.73	21890473
146	S-palmitoylation	MQADFKCCGAANYTD HHHHHCCCCCCCCCC	4.24	29575903
150	N-linked_Glycosylation	FKCCGAANYTDWEKI HCCCCCCCCCCHHHC	39.44	17660510
152	Phosphorylation	CCGAANYTDWEKIPS CCCCCCCCCHHHCCC	34.15	29759185
159	Phosphorylation	TDWEKIPSMSKNRVP CCHHHCCCCCCCCCC	38.88	21406692
161	Phosphorylation	WEKIPSMSKNRVPDS HHHCCCCCCCCCCCC	30.99	21406692
162	Ubiquitination	EKIPSMSKNRVPDSC HHCCCCCCCCCCCCC	39.88	21890473
169	S-palmitoylation	KNRVPDSCCINVTVG CCCCCCCCEEEEEEC	3.35	29575903
170	S-palmitoylation	NRVPDSCCINVTVGC CCCCCCCEEEEEECC	2.69	29575903
172	N-linked_Glycosylation	VPDSCCINVTVGCGI CCCCCEEEEEECCCC	14.97	17660510
177	S-palmitoylation	CINVTVGCGINFNEK EEEEEECCCCCCCCH	4.26	29575903
188	2-Hydroxyisobutyrylation	FNEKAIHKEGCVEKI CCCHHHCCCCCHHHH	50.08	-
188	Ubiquitination	FNEKAIHKEGCVEKI CCCHHHCCCCCHHHH	50.08	-
194	Ubiquitination	HKEGCVEKIGGWLRK CCCCCHHHHCHHHHH	26.67	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CD63_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CD63_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CD63_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KIT_HUMAN	KIT	physical	12036870
CD9_HUMAN	CD9	physical	8630057
FPRP_HUMAN	PTGFRN	physical	11278880
ITB1_HUMAN	ITGB1	physical	12175627
DRA_HUMAN	HLA-DRA	physical	9759843
CD82_HUMAN	CD82	physical	9759843
DMB_HUMAN	HLA-DMB	physical	9759843
DOB_HUMAN	HLA-DOB	physical	9759843
GAG_HV1H2	gag	physical	10708443
CD81_HUMAN	CD81	physical	16533950
ENV_HV1H2	env	physical	10708443
SDC1_HUMAN	SDC1	physical	22660413
SDCB1_HUMAN	SDCBP	physical	22660413

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CD63_HUMAN

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-130, AND MASSSPECTROMETRY.	19159218 [Abstract]
"Identification and quantification of N-linked glycoproteins usinghydrazide chemistry, stable isotope labeling and mass spectrometry."; Zhang H., Li X.-J., Martin D.B., Aebersold R.; Nat. Biotechnol. 21:660-666(2003). Cited for: GLYCOSYLATION AT ASN-130.	12754519 [Abstract]