UniProt ID | CD9_HUMAN | |
---|---|---|
UniProt AC | P21926 | |
Protein Name | CD9 antigen | |
Gene Name | CD9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 228 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . Cell membrane Multi-pass membrane protein . |
|
Protein Description | Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion.. | |
Protein Sequence | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | S-palmitoylation | PVKGGTKCIKYLLFG CCCCHHHHHHHHHHH | 3.05 | 11959120 | |
52 | N-linked_Glycosylation | FEQETNNNNSSFYTG HHHHCCCCCCCCHHH | 52.40 | UniProtKB CARBOHYD | |
53 | N-linked_Glycosylation | EQETNNNNSSFYTGV HHHCCCCCCCCHHHH | 40.95 | UniProtKB CARBOHYD | |
78 | S-palmitoylation | MLVGFLGCCGAVQES HHHHHHHHHHHHHHH | 1.79 | 11959120 | |
79 | S-palmitoylation | LVGFLGCCGAVQESQ HHHHHHHHHHHHHHH | 3.58 | 11959120 | |
87 | S-palmitoylation | GAVQESQCMLGLFFG HHHHHHHHHHHHHHH | 3.19 | 11959120 | |
125 | Phosphorylation | IKEVQEFYKDTYNKL HHHHHHHHHHHHHHC | 13.75 | - | |
126 | Methylation | KEVQEFYKDTYNKLK HHHHHHHHHHHHHCC | 49.25 | - | |
126 | Ubiquitination | KEVQEFYKDTYNKLK HHHHHHHHHHHHHCC | 49.25 | 21906983 | |
126 | Acetylation | KEVQEFYKDTYNKLK HHHHHHHHHHHHHCC | 49.25 | 27452117 | |
131 | Ubiquitination | FYKDTYNKLKTKDEP HHHHHHHHCCCCCCC | 40.73 | 21906983 | |
131 | 2-Hydroxyisobutyrylation | FYKDTYNKLKTKDEP HHHHHHHHCCCCCCC | 40.73 | - | |
133 | Ubiquitination | KDTYNKLKTKDEPQR HHHHHHCCCCCCCHH | 55.95 | 21906983 | |
135 | Ubiquitination | TYNKLKTKDEPQRET HHHHCCCCCCCHHHH | 59.51 | 21906983 | |
167 | S-palmitoylation | EQFISDICPKKDVLE HHHHHHHCCCCCHHH | 4.92 | 29575903 | |
170 | Ubiquitination | ISDICPKKDVLETFT HHHHCCCCCHHHHHC | 37.91 | 21906983 | |
175 | Phosphorylation | PKKDVLETFTVKSCP CCCCHHHHHCCCCCC | 22.05 | 23312004 | |
177 | Phosphorylation | KDVLETFTVKSCPDA CCHHHHHCCCCCCHH | 34.15 | 23312004 | |
179 | Ubiquitination | VLETFTVKSCPDAIK HHHHHCCCCCCHHHH | 43.19 | - | |
186 | Ubiquitination | KSCPDAIKEVFDNKF CCCCHHHHHHHCCCC | 49.93 | - | |
218 | S-palmitoylation | MIFSMILCCAIRRNR HHHHHHHHHHHHHHH | 0.73 | 11959120 | |
219 | S-palmitoylation | IFSMILCCAIRRNRE HHHHHHHHHHHHHHC | 2.94 | 11959120 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KIT_HUMAN | KIT | physical | 12036870 | |
ITB1_HUMAN | ITGB1 | physical | 8630057 | |
IGSF8_HUMAN | IGSF8 | physical | 11504738 | |
MCP_HUMAN | CD46 | physical | 10741407 | |
TSN4_HUMAN | TSPAN4 | physical | 9360996 | |
FPRP_HUMAN | PTGFRN | physical | 11278880 | |
ITB1_HUMAN | ITGB1 | physical | 12175627 | |
CD53_HUMAN | CD53 | physical | 11959120 | |
SERPH_HUMAN | SERPINH1 | physical | 10227388 | |
KPCA_HUMAN | PRKCA | physical | 11325968 | |
FPRP_HUMAN | PTGFRN | physical | 11087758 | |
FPRP_HUMAN | PTGFRN | physical | 23091066 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...