UniProt ID | CD53_HUMAN | |
---|---|---|
UniProt AC | P19397 | |
Protein Name | Leukocyte surface antigen CD53 | |
Gene Name | CD53 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 219 | |
Subcellular Localization |
Cell membrane. Cell junction. Membrane Multi-pass membrane protein. Concentrates in localized microdomains along the plasma membrane at the contact sites between cells of fused myotubes.. |
|
Protein Description | Required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells (By similarity).. | |
Protein Sequence | MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
116 | Ubiquitination | KLNEYVAKGLTDSIH HHHHHHHCCCCHHHH | 44.39 | - | |
129 | N-linked_Glycosylation | IHRYHSDNSTKAAWD HHHHCCCCCCHHHHH | 55.37 | UniProtKB CARBOHYD | |
148 | N-linked_Glycosylation | FLQCCGINGTSDWTS HHHHHCCCCCCCCCC | 32.73 | UniProtKB CARBOHYD | |
166 | Ubiquitination | ASCPSDRKVEGCYAK CCCCCCCCCCCCHHH | 50.02 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD53_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD53_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD53_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KPCA_HUMAN | PRKCA | physical | 11325968 | |
GGT1_HUMAN | GGT1 | physical | 9862348 | |
CD81_HUMAN | CD81 | physical | 9862348 | |
CD82_HUMAN | CD82 | physical | 9862348 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...