UniProt ID | NDP_HUMAN | |
---|---|---|
UniProt AC | Q00604 | |
Protein Name | Norrin | |
Gene Name | NDP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 133 | |
Subcellular Localization | Secreted . | |
Protein Description | Activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. Plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. Acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). May be involved in a pathway that regulates neural cell differentiation and proliferation. Possible role in neuroectodermal cell-cell interaction.. | |
Protein Sequence | MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | AASFSMLSLLVIMGD HHHHHHHHHHHHHCC | 15.83 | 19413330 | |
26 | Phosphorylation | MGDTDSKTDSSFIMD HCCCCCCCCCCCCCC | 45.10 | 29083192 | |
28 | Phosphorylation | DTDSKTDSSFIMDSD CCCCCCCCCCCCCCC | 32.17 | 29083192 | |
29 | Phosphorylation | TDSKTDSSFIMDSDP CCCCCCCCCCCCCCH | 22.92 | 29083192 | |
34 | Phosphorylation | DSSFIMDSDPRRCMR CCCCCCCCCHHHHHH | 31.94 | 29083192 | |
120 | Phosphorylation | GMRLTATYRYILSCH CCEEEEEEEEHHHEE | 10.04 | 29759185 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDP_HUMAN !! |
loading...