NDP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDP_HUMAN
• UniProt AC: Q00604
• Protein Name: Norrin
• Gene Name: NDP
• Organism: Homo sapiens (Human).
• Sequence Length: 133
• Subcellular Localization: Secreted .
• Protein Description: Activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. Plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. Acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). May be involved in a pathway that regulates neural cell differentiation and proliferation. Possible role in neuroectodermal cell-cell interaction..
• Protein Sequence: MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	AASFSMLSLLVIMGD HHHHHHHHHHHHHCC	15.83	19413330
26	Phosphorylation	MGDTDSKTDSSFIMD HCCCCCCCCCCCCCC	45.10	29083192
28	Phosphorylation	DTDSKTDSSFIMDSD CCCCCCCCCCCCCCC	32.17	29083192
29	Phosphorylation	TDSKTDSSFIMDSDP CCCCCCCCCCCCCCH	22.92	29083192
34	Phosphorylation	DSSFIMDSDPRRCMR CCCCCCCCCHHHHHH	31.94	29083192
120	Phosphorylation	GMRLTATYRYILSCH CCEEEEEEEEHHHEE	10.04	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
FZD4_HUMAN	FZD4	physical	15035989
NDP_HUMAN	NDP	physical	17955262

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 310600: Norrie disease (ND)
• 305390: Vitreoretinopathy, exudative 2 (EVR2)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.