dbPTM

DPA1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DPA1_HUMAN
UniProt AC	P20036
Protein Name	HLA class II histocompatibility antigen, DP alpha 1 chain
Gene Name	HLA-DPA1
Organism	Homo sapiens (Human).
Sequence Length	260
Subcellular Localization	Cell membrane Single-pass type I membrane protein. Endoplasmic reticulum membrane Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane Single-pass type I membrane protein. Endosome membrane Single-pass type I membrane pro
Protein Description	Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading..
Protein Sequence	MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
109	N-linked_Glycosylation	NTLIQRSNHTQATND HHHHHHCCCCCCCCC	44.40	UniProtKB CARBOHYD
149	N-linked_Glycosylation	KFFPPVLNVTWLCNG HCCCCCCEEEEEECC	29.43	19159218
174	Phosphorylation	LFLPRTDYSFHKFHY HCCCCCCCCEEEEEE	16.78	-
178	Ubiquitination	RTDYSFHKFHYLTFV CCCCCEEEEEEEEEC	31.65	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DPA1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DPA1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DPA1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYO9B_HUMAN	MYO9B	physical	26186194
DIM1_HUMAN	DIMT1	physical	26186194
ASPM_HUMAN	ASPM	physical	26186194
RMD3_HUMAN	RMDN3	physical	26186194
GOLI4_HUMAN	GOLIM4	physical	26186194
HLAF_HUMAN	HLA-F	physical	26186194
1A02_HUMAN	HLA-A	physical	26186194
1A03_HUMAN	HLA-A	physical	26186194
1A01_HUMAN	HLA-A	physical	26186194
1A26_HUMAN	HLA-A	physical	26186194
S22AI_HUMAN	SLC22A18	physical	26186194
TOR1B_HUMAN	TOR1B	physical	26186194
KDIS_HUMAN	KIDINS220	physical	26186194
AT132_HUMAN	ATP13A2	physical	26186194
SRBP2_HUMAN	SREBF2	physical	26186194
CQ080_HUMAN	C17orf80	physical	26186194
LRFN1_HUMAN	LRFN1	physical	26186194
ABCB6_HUMAN	ABCB6	physical	26186194
S38AA_HUMAN	SLC38A10	physical	26186194
P121A_HUMAN	POM121	physical	26186194
SORL_HUMAN	SORL1	physical	26186194
DSE_HUMAN	DSE	physical	26186194
NDUA3_HUMAN	NDUFA3	physical	26186194
PLPL6_HUMAN	PNPLA6	physical	26186194
DCBD1_HUMAN	DCBLD1	physical	26186194
PTPRS_HUMAN	PTPRS	physical	26186194
RL23_HUMAN	RPL23	physical	26186194
SCRB1_HUMAN	SCARB1	physical	26186194
SPB4_HUMAN	SERPINB4	physical	26186194
TM246_HUMAN	TMEM246	physical	26186194
FKTN_HUMAN	FKTN	physical	26186194
ULBP3_HUMAN	ULBP3	physical	26186194
QSOX2_HUMAN	QSOX2	physical	26186194
GDC_HUMAN	SLC25A16	physical	26186194
PCAT2_HUMAN	LPCAT2	physical	26186194
CLUS_HUMAN	CLU	physical	26186194
PDK1_HUMAN	PDK1	physical	26186194
LCAP_HUMAN	LNPEP	physical	26186194
FUT4_HUMAN	FUT4	physical	26186194
NGBR_HUMAN	NUS1	physical	26186194
KIRR1_HUMAN	KIRREL	physical	26186194
NR3L1_HUMAN	NCR3LG1	physical	26186194
EFNB1_HUMAN	EFNB1	physical	26186194
EFNB3_HUMAN	EFNB3	physical	26186194
TYW5_HUMAN	TYW5	physical	26186194
LTBP1_HUMAN	LTBP1	physical	26186194
AT2C1_HUMAN	ATP2C1	physical	26186194
DAG1_HUMAN	DAG1	physical	26186194
F210A_HUMAN	FAM210A	physical	26186194
GLT11_HUMAN	GALNT11	physical	26186194
HS3SB_HUMAN	HS3ST3B1	physical	26186194
SFXN1_HUMAN	SFXN1	physical	26186194
TAF6L_HUMAN	TAF6L	physical	26186194
CHSS1_HUMAN	CHSY1	physical	26186194
INT7_HUMAN	INTS7	physical	26186194
MTX1_HUMAN	MTX1	physical	26186194
B4GT4_HUMAN	B4GALT4	physical	26186194
B4GT3_HUMAN	B4GALT3	physical	26186194
TIP_HUMAN	ITFG1	physical	26186194
HBD_HUMAN	HBD	physical	26186194
TM201_HUMAN	TMEM201	physical	26186194
ABCBA_HUMAN	ABCB10	physical	26186194
EGFL7_HUMAN	EGFL7	physical	26186194
ORNT1_HUMAN	SLC25A15	physical	26186194
GPAT3_HUMAN	AGPAT9	physical	26186194
HXA5_HUMAN	HOXA5	physical	26186194
APOE_HUMAN	APOE	physical	26186194
NMU_HUMAN	NMU	physical	26186194
PCDH9_HUMAN	PCDH9	physical	26186194
NOB1_HUMAN	NOB1	physical	26186194
RER1_HUMAN	RER1	physical	26186194
NF1_HUMAN	NF1	physical	26186194
KLRG2_HUMAN	KLRG2	physical	26186194
EPHA7_HUMAN	EPHA7	physical	26186194
EPHA4_HUMAN	EPHA4	physical	26186194
HXD13_HUMAN	HOXD13	physical	26186194
CHSTB_HUMAN	CHST11	physical	26186194
SAMD1_HUMAN	SAMD1	physical	26186194
FKRP_HUMAN	FKRP	physical	26186194
MYO19_HUMAN	MYO19	physical	26186194
DPB1_HUMAN	HLA-DPB1	physical	26186194
BT2A1_HUMAN	BTN2A1	physical	26186194
TNFL9_HUMAN	TNFSF9	physical	26186194
GALA_HUMAN	GAL	physical	26186194
B4GT5_HUMAN	B4GALT5	physical	26186194
QSOX1_HUMAN	QSOX1	physical	26186194
APOE_HUMAN	APOE	physical	28514442
NOB1_HUMAN	NOB1	physical	28514442
DCBD1_HUMAN	DCBLD1	physical	28514442
AT132_HUMAN	ATP13A2	physical	28514442
FKTN_HUMAN	FKTN	physical	28514442
FUT4_HUMAN	FUT4	physical	28514442
NMU_HUMAN	NMU	physical	28514442
TYW5_HUMAN	TYW5	physical	28514442
DSE_HUMAN	DSE	physical	28514442
GOLI4_HUMAN	GOLIM4	physical	28514442
PTPRS_HUMAN	PTPRS	physical	28514442
ULBP3_HUMAN	ULBP3	physical	28514442
SPB4_HUMAN	SERPINB4	physical	28514442
B4GT4_HUMAN	B4GALT4	physical	28514442
B4GT5_HUMAN	B4GALT5	physical	28514442
EFNB3_HUMAN	EFNB3	physical	28514442
S22AI_HUMAN	SLC22A18	physical	28514442
DAG1_HUMAN	DAG1	physical	28514442
LTBP1_HUMAN	LTBP1	physical	28514442
S38AA_HUMAN	SLC38A10	physical	28514442
TOR1B_HUMAN	TOR1B	physical	28514442
TNFL9_HUMAN	TNFSF9	physical	28514442
1A02_HUMAN	HLA-A	physical	28514442
1A03_HUMAN	HLA-A	physical	28514442
1A01_HUMAN	HLA-A	physical	28514442
1A26_HUMAN	HLA-A	physical	28514442
SORL_HUMAN	SORL1	physical	28514442
RN167_HUMAN	RNF167	physical	28514442
QSOX1_HUMAN	QSOX1	physical	28514442
GALA_HUMAN	GAL	physical	28514442
DPB1_HUMAN	HLA-DPB1	physical	28514442
INT7_HUMAN	INTS7	physical	28514442
ORNT1_HUMAN	SLC25A15	physical	28514442
B4GT3_HUMAN	B4GALT3	physical	28514442
SRBP2_HUMAN	SREBF2	physical	28514442
FGRL1_HUMAN	FGFRL1	physical	28514442
GDC_HUMAN	SLC25A16	physical	28514442
GLT11_HUMAN	GALNT11	physical	28514442
NGBR_HUMAN	NUS1	physical	28514442
GXLT2_HUMAN	GXYLT2	physical	28514442
SAMD1_HUMAN	SAMD1	physical	28514442
LCAP_HUMAN	LNPEP	physical	28514442
HS3SB_HUMAN	HS3ST3B1	physical	28514442
CQ080_HUMAN	C17orf80	physical	28514442
TIP_HUMAN	ITFG1	physical	28514442
NUCB1_HUMAN	NUCB1	physical	28514442
KIRR1_HUMAN	KIRREL	physical	28514442
EFNB1_HUMAN	EFNB1	physical	28514442
GL8D1_HUMAN	GLT8D1	physical	28514442
BT2A1_HUMAN	BTN2A1	physical	28514442
CHSTB_HUMAN	CHST11	physical	28514442
FKRP_HUMAN	FKRP	physical	28514442
P121A_HUMAN	POM121	physical	28514442
NDUA3_HUMAN	NDUFA3	physical	28514442
RL23_HUMAN	RPL23	physical	28514442
CLUS_HUMAN	CLU	physical	28514442
CHSS1_HUMAN	CHSY1	physical	28514442
POTEF_HUMAN	POTEF	physical	28514442
EGFL7_HUMAN	EGFL7	physical	28514442
PDK1_HUMAN	PDK1	physical	28514442
QSOX2_HUMAN	QSOX2	physical	28514442
KLRG2_HUMAN	KLRG2	physical	28514442
TM201_HUMAN	TMEM201	physical	28514442

Drug and Disease Associations

Kegg Disease
H00294	Dilated cardiomyopathy (DCM)
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DPA1_HUMAN

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-149, AND MASSSPECTROMETRY.	19159218 [Abstract]