| UniProt ID | GDC_HUMAN | |
|---|---|---|
| UniProt AC | P16260 | |
| Protein Name | Graves disease carrier protein | |
| Gene Name | SLC25A16 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 332 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Required for the accumulation of coenzyme A in the mitochondrial matrix.. | |
| Protein Sequence | MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MAAATAAAALAA ---CHHHHHHHHHHH | 16.47 | 28674151 | |
| 29 | Phosphorylation | AAGAGGPTTRRDFYW CCCCCCCCCHHHHHH | 35.89 | 28674151 | |
| 30 | Phosphorylation | AGAGGPTTRRDFYWL CCCCCCCCHHHHHHH | 27.17 | 28674151 | |
| 51 | Malonylation | GIAGCCAKTTVAPLD CCCHHCCCCCCCCHH | 30.71 | 26320211 | |
| 78 | Phosphorylation | YKHLGVFSALRAVPQ HHHHHHHHHHCCCCC | 24.80 | 23898821 | |
| 123 | O-linked_Glycosylation | HYKTLITTKLGISGH CHHHHHHHHHCCCCH | 19.78 | 29351928 | |
| 149 | Phosphorylation | MTAVICTYPLDMVRV CEEEEECCCCCCEEE | 9.44 | - | |
| 189 | Phosphorylation | EGGFFGFYRGLMPTI CCCCHHCCCCHHHHH | 12.26 | - | |
| 195 | O-linked_Glycosylation | FYRGLMPTILGMAPY CCCCHHHHHHCCCCC | 18.18 | 29351928 | |
| 206 | O-linked_Glycosylation | MAPYAGVSFFTFGTL CCCCCCEEEEECCCH | 17.45 | 29351928 | |
| 289 | Phosphorylation | TMRDTMKYVYGHHGI CHHHHHHHHHCCCCH | 6.51 | 18669648 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDC_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDC_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GDC_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
