UniProt ID | F210A_HUMAN | |
---|---|---|
UniProt AC | Q96ND0 | |
Protein Name | Protein FAM210A | |
Gene Name | FAM210A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 272 | |
Subcellular Localization |
Membrane Single-pass membrane protein . Mitochondrion . |
|
Protein Description | ||
Protein Sequence | MQWNVPRTVSRLARRTCLEPHNAGLFGHCQNVKGPLLLYNAESKVVLVQGPQKQWLHLSAAQCVAKERRPLDAHPPQPGVLRHKQGKQHVSFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MQWNVPRTVSRLARR CCCCCCHHHHHHHHH | 19.43 | 24043423 | |
10 | Phosphorylation | WNVPRTVSRLARRTC CCCCHHHHHHHHHHH | 22.44 | 24043423 | |
99 | Phosphorylation | FRRVFSSSATAQGTP EEEHHHCCCCCCCCC | 28.57 | 22210691 | |
118 | Ubiquitination | EPDPLQDKSISLYQR CCCCCCCHHHHHHHH | 36.41 | 29967540 | |
123 | Phosphorylation | QDKSISLYQRFKKTF CCHHHHHHHHHHHHH | 7.28 | 25839225 | |
177 | Phosphorylation | GLPDSVVSILKNSQS CCCHHHHHHHHCCCC | 21.76 | 24719451 | |
202 | Phosphorylation | KIATPARYTVTLGGT HHCCCCEEEEEECCE | 13.99 | 29759185 | |
203 | Phosphorylation | IATPARYTVTLGGTS HCCCCEEEEEECCEE | 11.06 | 29759185 | |
209 | Phosphorylation | YTVTLGGTSVTVKYL EEEEECCEEEEEEEH | 20.44 | 20068231 | |
210 | Phosphorylation | TVTLGGTSVTVKYLR EEEECCEEEEEEEHH | 21.04 | 20068231 | |
212 | Phosphorylation | TLGGTSVTVKYLRSH EECCEEEEEEEHHHC | 15.85 | 20068231 | |
215 | Phosphorylation | GTSVTVKYLRSHGYM CEEEEEEEHHHCCCC | 11.74 | - | |
221 | Phosphorylation | KYLRSHGYMSTPPPV EEHHHCCCCCCCCCH | 5.18 | 22210691 | |
223 | Phosphorylation | LRSHGYMSTPPPVKE HHHCCCCCCCCCHHH | 29.31 | 22210691 | |
246 | 2-Hydroxyisobutyrylation | TKELITEKMEETKDR HHHHHHHHHHHHHHH | 42.85 | - | |
257 | 2-Hydroxyisobutyrylation | TKDRLTEKLQETKEK HHHHHHHHHHHHHHH | 50.68 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F210A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F210A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F210A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
F210A_HUMAN | FAM210A | physical | 26472760 | |
COPA_HUMAN | COPA | physical | 26472760 | |
COPB2_HUMAN | COPB2 | physical | 26472760 | |
RCN2_HUMAN | RCN2 | physical | 26472760 | |
COPE_HUMAN | COPE | physical | 26472760 | |
MYL6_HUMAN | MYL6 | physical | 26472760 | |
DNJA2_HUMAN | DNAJA2 | physical | 26472760 | |
LDHB_HUMAN | LDHB | physical | 26472760 | |
IFT52_HUMAN | IFT52 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...