UniProt ID | GALA_HUMAN | |
---|---|---|
UniProt AC | P22466 | |
Protein Name | Galanin peptides | |
Gene Name | GAL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 123 | |
Subcellular Localization | Secreted . | |
Protein Description | Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1, GALR2, and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion.. | |
Protein Sequence | MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | LLLAAALSASAGLWS HHHHHHHHHHCCCCC | 18.56 | - | |
35 | O-linked_Glycosylation | AKEKRGWTLNSAGYL CHHHCCCEECCCHHH | 20.91 | 55824207 | |
53 | Phosphorylation | HAVGNHRSFSDKNGL CCCCCCCCCCCCCCC | 22.88 | 27134283 | |
57 | Ubiquitination | NHRSFSDKNGLTSKR CCCCCCCCCCCCCCC | 52.28 | 27667366 | |
63 | Ubiquitination | DKNGLTSKRELRPED CCCCCCCCCCCCCHH | 44.66 | 23503661 | |
73 | Ubiquitination | LRPEDDMKPGSFDRS CCCHHCCCCCCCCCC | 53.90 | 23503661 | |
76 | Phosphorylation | EDDMKPGSFDRSIPE HHCCCCCCCCCCCCC | 32.28 | 23312004 | |
89 | Phosphorylation | PENNIMRTIIEFLSF CCCHHHHHHHHHHHH | 14.66 | - | |
95 | Phosphorylation | RTIIEFLSFLHLKEA HHHHHHHHHHHHHHC | 30.96 | - | |
116 | Phosphorylation | LDLPAAASSEDIERS HCCCCHHCHHHHHCC | 29.54 | 28355574 | |
117 | Phosphorylation | DLPAAASSEDIERS- CCCCHHCHHHHHCC- | 34.26 | 25159151 | |
123 | Phosphorylation | SSEDIERS------- CHHHHHCC------- | 31.61 | 30175587 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GALA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GALA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GALA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GALA_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteomic analysis of the human pituitary."; Beranova-Giorgianni S., Zhao Y., Desiderio D.M., Giorgianni F.; Pituitary 9:109-120(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117, AND MASSSPECTROMETRY. | |
"Identification and characterization of phosphorylated proteins in thehuman pituitary."; Giorgianni F., Beranova-Giorgianni S., Desiderio D.M.; Proteomics 4:587-598(2004). Cited for: PHOSPHORYLATION AT SER-117. |