UniProt ID | EGFL7_HUMAN | |
---|---|---|
UniProt AC | Q9UHF1 | |
Protein Name | Epidermal growth factor-like protein 7 | |
Gene Name | EGFL7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 273 | |
Subcellular Localization | Secreted, extracellular space . | |
Protein Description | Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis.. | |
Protein Sequence | MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MRGSQEVLLMW ----CCCHHHHHHHH | 16.89 | 24043423 | |
20 | Phosphorylation | LVLAVGGTEHAYRPG HHHHHCCCHHHCCCC | 20.76 | 24043423 | |
24 | Phosphorylation | VGGTEHAYRPGRRVC HCCCHHHCCCCCCEE | 21.17 | 24043423 | |
49 | Phosphorylation | ESFVQRVYQPFLTTC HHHHHHHHHCHHCCC | 16.80 | - | |
54 | Phosphorylation | RVYQPFLTTCDGHRA HHHHCHHCCCCCCHH | 26.25 | - | |
54 | O-linked_Glycosylation | RVYQPFLTTCDGHRA HHHHCHHCCCCCCHH | 26.25 | 46203823 | |
55 | Phosphorylation | VYQPFLTTCDGHRAC HHHCHHCCCCCCHHH | 15.67 | - | |
55 | O-linked_Glycosylation | VYQPFLTTCDGHRAC HHHCHHCCCCCCHHH | 15.67 | 55831561 | |
65 | Phosphorylation | GHRACSTYRTIYRTA CCHHHHHHHHHHHHH | 6.89 | - | |
67 | Phosphorylation | RACSTYRTIYRTAYR HHHHHHHHHHHHHHH | 16.37 | 30576142 | |
69 | Phosphorylation | CSTYRTIYRTAYRRS HHHHHHHHHHHHHHC | 10.99 | 30576142 | |
71 | Phosphorylation | TYRTIYRTAYRRSPG HHHHHHHHHHHHCCC | 15.86 | 30576142 | |
93 | Ubiquitination | YACCPGWKRTSGLPG EEECCCCCCCCCCCC | 52.27 | 21890473 | |
190 | O-linked_Glycosylation | PRVAPNPTGVDSAMK CCCCCCCCCHHHHHH | 57.38 | 55834273 | |
197 | Ubiquitination | TGVDSAMKEEVQRLQ CCHHHHHHHHHHHHH | 50.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EGFL7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EGFL7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EGFL7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SMRD1_HUMAN | SMARCD1 | physical | 21988832 | |
NOTC1_HUMAN | NOTCH1 | physical | 19503073 | |
NOTC2_HUMAN | NOTCH2 | physical | 19503073 | |
NOTC3_HUMAN | NOTCH3 | physical | 19503073 | |
NOTC4_HUMAN | NOTCH4 | physical | 19503073 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...