| UniProt ID | TYW5_HUMAN | |
|---|---|---|
| UniProt AC | A2RUC4 | |
| Protein Name | tRNA wybutosine-synthesizing protein 5 | |
| Gene Name | TYW5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 315 | |
| Subcellular Localization | ||
| Protein Description | tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes.. | |
| Protein Sequence | MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Ubiquitination | QHLYPQRKPLVLEGI HHHCCCCCCEEEECC | 37.14 | 29967540 | |
| 48 | Phosphorylation | TSKWTVDYLSQVGGK CCCCHHHHHHHCCCC | 12.15 | 22817900 | |
| 95 | Ubiquitination | RAAEEKHKEFFVSED HHHHHHCHHCCCCCC | 68.25 | 29967540 | |
| 187 | Phosphorylation | FSPRDAQYLYLKGTK ECCHHCEEEEEECCC | 10.07 | 26074081 | |
| 189 | Phosphorylation | PRDAQYLYLKGTKSE CHHCEEEEEECCCCC | 11.05 | 26074081 | |
| 193 | Phosphorylation | QYLYLKGTKSEVLNI EEEEEECCCCCEECC | 29.79 | 26074081 | |
| 194 | Malonylation | YLYLKGTKSEVLNID EEEEECCCCCEECCC | 53.97 | 26320211 | |
| 195 | Phosphorylation | LYLKGTKSEVLNIDN EEEECCCCCEECCCC | 32.54 | 26074081 | |
| 207 | Ubiquitination | IDNPDLAKYPLFSKA CCCHHHHHCCHHHCC | 55.48 | 29967540 | |
| 207 | Acetylation | IDNPDLAKYPLFSKA CCCHHHHHCCHHHCC | 55.48 | 26051181 | |
| 212 | Phosphorylation | LAKYPLFSKARRYEC HHHCCHHHCCCCEEC | 32.84 | 24719451 | |
| 260 | Ubiquitination | LPSECYDKTDTYGNK CCHHHCCCCCCCCCC | 23.09 | 29967540 | |
| 267 | Ubiquitination | KTDTYGNKDPTAASR CCCCCCCCCHHHHHH | 61.80 | 29967540 | |
| 285 | Phosphorylation | ILDRALKTLAELPEE HHHHHHHHHHHCCHH | 31.86 | - | |
| 293 | Phosphorylation | LAELPEEYRDFYARR HHHCCHHHHHHHHHH | 17.51 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TYW5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TYW5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TYW5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| POTEF_HUMAN | POTEF | physical | 26186194 | |
| POTEF_HUMAN | POTEF | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
