UniProt ID | TNFL9_HUMAN | |
---|---|---|
UniProt AC | P41273 | |
Protein Name | Tumor necrosis factor ligand superfamily member 9 | |
Gene Name | TNFSF9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 254 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein. |
|
Protein Description | Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.. | |
Protein Sequence | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MEYASDASLD -----CCCCCCCCCC | 15.31 | 21955146 | |
5 | Phosphorylation | ---MEYASDASLDPE ---CCCCCCCCCCCC | 32.57 | 21955146 | |
8 | Phosphorylation | MEYASDASLDPEAPW CCCCCCCCCCCCCCC | 37.99 | 21955146 | |
64 | Phosphorylation | GARASPGSAASPRLR CCCCCCCCCCCCCCC | 24.85 | 26270265 | |
67 | Phosphorylation | ASPGSAASPRLREGP CCCCCCCCCCCCCCC | 15.40 | 26270265 | |
131 | Ubiquitination | LSYKEDTKELVVAKA CCCCCCCCEEEEEEC | 62.46 | - | |
158 | Phosphorylation | RVVAGEGSGSVSLAL EHHCCCCCCEEEEEE | 24.48 | - | |
172 | Phosphorylation | LHLQPLRSAAGAAAL EECHHHHHHHHHHHH | 30.10 | - | |
182 | Phosphorylation | GAAALALTVDLPPAS HHHHHHHEEECCCCC | 13.33 | - | |
190 | Phosphorylation | VDLPPASSEARNSAF EECCCCCHHHHHHHC | 37.06 | - | |
250 | Phosphorylation | EIPAGLPSPRSE--- CCCCCCCCCCCC--- | 37.68 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNFL9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNFL9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNFL9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TNFL9_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...