| UniProt ID | SFP1_SCHPO | |
|---|---|---|
| UniProt AC | Q9UTH8 | |
| Protein Name | Zinc finger protein sfp1 | |
| Gene Name | sfp1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 442 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | ||
| Protein Sequence | MPSLALPINKPSHHNVNYNGNSFNSIHATSFGMSPQSWGNSFSGQAWLRDTIPSLSNVVESQTIPEEDSTSYLNRLEEAFCRDFRCCGQTLEDLHQLIHHYEEQHAVLATDSAVPQEYSLDSNNAAQSNHSHIQALKQRERIRMHDLADQLGTSEISDNSAVLPFAFPANGGAPGPYRVSVVVPAAAAAAAAAASSDMSSDEASSQAETTGTPKKMPESLVMDASSPLSDMSMSIDVGESAANNVFAFNQKDMVDSTYLPPFNYDHDVFSFAPSVASADQFTESSMSPTPEVVSPAATNSAISSPFVRKSSSDLEAKPSKKQRSTPAFSHDSPLTIDYPGSNLVVVDKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRTHSHLQVSMAQAQREVQMNFMRTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 310 | Phosphorylation | SSPFVRKSSSDLEAK CCCCCCCCCCCCCCC | 25.22 | 29996109 | |
| 311 | Phosphorylation | SPFVRKSSSDLEAKP CCCCCCCCCCCCCCC | 30.79 | 29996109 | |
| 312 | Phosphorylation | PFVRKSSSDLEAKPS CCCCCCCCCCCCCCC | 53.99 | 29996109 | |
| 377 | Phosphorylation | HKLHGHCSPITTPTP EEECCCCCCCCCCCC | 17.42 | 21712547 | |
| 380 | Phosphorylation | HGHCSPITTPTPAPI CCCCCCCCCCCCCCC | 30.06 | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFP1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFP1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFP1_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
