RLA2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RLA2_SCHPO
• UniProt AC: P08094
• Protein Name: 60S acidic ribosomal protein P2-alpha
• Gene Name: rpp201
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 110
• Protein Description: Plays an important role in the elongation step of protein synthesis..
• Protein Sequence: MKYLAAYLLLTVGGKDSPSASDIESVLSTVGIEAESERIETLINELNGKDIDELIAAGNEKLATVPTGGAASAAPAAAAGGAAPAAEEAAKEEAKEEEESDEDMGFGLFD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	LTVGGKDSPSASDIE HHCCCCCCCCHHHHH	25.00	25720772
19	Phosphorylation	VGGKDSPSASDIESV CCCCCCCCHHHHHHH	44.34	21712547
21	Phosphorylation	GKDSPSASDIESVLS CCCCCCHHHHHHHHH	43.38	25720772
25	Phosphorylation	PSASDIESVLSTVGI CCHHHHHHHHHHHCC	28.79	25720772
28	Phosphorylation	SDIESVLSTVGIEAE HHHHHHHHHHCCHHH	20.92	25720772
29	Phosphorylation	DIESVLSTVGIEAES HHHHHHHHHCCHHHH	20.70	25720772
67	Phosphorylation	EKLATVPTGGAASAA CCEECCCCCCHHHHH	43.86	29996109
72	Phosphorylation	VPTGGAASAAPAAAA CCCCCHHHHHHHHHH	25.16	21712547
100	Phosphorylation	EAKEEEESDEDMGFG HHHHHHHCCCCCCCC	49.97	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RLA2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RLA2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RLA2_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RLA2_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.