UniProt ID | U390_SCHPO | |
---|---|---|
UniProt AC | Q9P7I8 | |
Protein Name | UPF0390 protein C24B10.18 | |
Gene Name | SPCC24B10.18 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 93 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAQGEFKKKKNSSANKGGRVTKHSKNPKKGARYCAPRRAAAIKDHTINANITKTLNVRNEKLIAGIASQQVGKLTITKALGEAGAKELKEGKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of U390_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of U390_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of U390_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of U390_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YG58_SCHPO | SPBC56F2.08c | genetic | 22681890 | |
DPH3_SCHPO | dph3 | genetic | 22681890 | |
MEX67_SCHPO | mex67 | genetic | 22681890 | |
DPH1_SCHPO | SPBC3B8.05 | genetic | 22681890 | |
RAD55_SCHPO | rad55 | genetic | 22681890 | |
CHP1_SCHPO | chp1 | genetic | 22681890 | |
SSN3_SCHPO | srb10 | genetic | 22681890 | |
RAF1_SCHPO | raf1 | genetic | 22681890 | |
PTPA1_SCHPO | ypa1 | genetic | 22681890 | |
PVH1_SCHPO | SPBC17A3.06 | genetic | 22681890 | |
PRZ1_SCHPO | prz1 | genetic | 22681890 | |
SODM_SCHPO | SPAC1486.01 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...