| UniProt ID | DUS22_HUMAN | |
|---|---|---|
| UniProt AC | Q9NRW4 | |
| Protein Name | Dual specificity protein phosphatase 22 | |
| Gene Name | DUSP22 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 184 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity).. | |
| Protein Sequence | MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-myristoyl glycine | ------MGNGMNKIL ------CCCCCHHCC | 39.12 | - | |
| 2 | Myristoylation | ------MGNGMNKIL ------CCCCCHHCC | 39.12 | 20553486 | |
| 18 | Ubiquitination | GLYIGNFKDARDAEQ CCEECCCCCHHHHHH | 55.25 | - | |
| 18 (in isoform 2) | Ubiquitination | - | 55.25 | - | |
| 36 | Phosphorylation | NKVTHILSVHDSARP CCCEEEEECCCCCCH | 19.46 | 23312004 | |
| 50 | Phosphorylation | PMLEGVKYLCIPAAD HHHCCCCEEEEECCC | 12.37 | 30108239 | |
| 58 | Phosphorylation | LCIPAADSPSQNLTR EEEECCCCCCHHHHH | 23.02 | 23401153 | |
| 60 | Phosphorylation | IPAADSPSQNLTRHF EECCCCCCHHHHHHH | 35.34 | 25159151 | |
| 64 | Phosphorylation | DSPSQNLTRHFKESI CCCCHHHHHHHHHHH | 29.64 | 30576142 | |
| 83 | Phosphorylation | ECRLRGESCLVHCLA HHHHCCCHHHHHHHH | 18.64 | 22210691 | |
| 93 | Phosphorylation | VHCLAGVSRSVTLVI HHHHHCCCHHHHHHH | 20.23 | 22210691 | |
| 151 | Ubiquitination | HQYRQWLKEEYGESP HHHHHHHHHHHCCCC | 45.61 | - | |
| 166 | Ubiquitination | LQDAEEAKNILAAPG CCCHHHHHHHHHHHH | 48.04 | - | |
| 178 (in isoform 2) | Phosphorylation | - | 5.63 | 24719451 | |
| 188 (in isoform 2) | Phosphorylation | - | 28450419 | ||
| 189 (in isoform 2) | Phosphorylation | - | 28450419 | ||
| 197 (in isoform 2) | Phosphorylation | - | 28842319 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DUS22_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DUS22_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DUS22_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Myristoylation | |
| Reference | PubMed |
| "Myristoylation of the dual-specificity phosphatase c-JUN N-terminalkinase (JNK) stimulatory phosphatase 1 is necessary for its activationof JNK signaling and apoptosis."; Schwertassek U., Buckley D.A., Xu C.F., Lindsay A.J., McCaffrey M.W.,Neubert T.A., Tonks N.K.; FEBS J. 277:2463-2473(2010). Cited for: MYRISTOYLATION AT GLY-2. | |
