UniProt ID | SVIP_HUMAN | |
---|---|---|
UniProt AC | Q8NHG7 | |
Protein Name | Small VCP/p97-interacting protein | |
Gene Name | SVIP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 77 | |
Subcellular Localization |
Smooth endoplasmic reticulum membrane Peripheral membrane protein. Golgi apparatus membrane Peripheral membrane protein. Cell membrane Peripheral membrane protein. Membrane Lipid-anchor . |
|
Protein Description | ||
Protein Sequence | MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGLCFPCPG ------CCCCCCCCC | 31.02 | 25255805 | |
11 | Phosphorylation | CFPCPGESAPPTPDL CCCCCCCCCCCCCCH | 52.57 | 26657352 | |
15 | Phosphorylation | PGESAPPTPDLEEKR CCCCCCCCCCHHHHH | 28.51 | 26657352 | |
24 | Ubiquitination | DLEEKRAKLAEAAER CHHHHHHHHHHHHHH | 52.87 | 33845483 | |
34 | Ubiquitination | EAAERRQKEAASRGI HHHHHHHHHHHHCCC | 47.73 | 29967540 | |
36 | Ubiquitination | AERRQKEAASRGILD HHHHHHHHHHCCCCC | 20.13 | 29967540 | |
46 | Phosphorylation | RGILDVQSVQEKRKK CCCCCHHHHHHHHHH | 26.14 | 29255136 | |
50 | Ubiquitination | DVQSVQEKRKKKEKI CHHHHHHHHHHHHHH | 53.04 | 33845483 | |
52 | Ubiquitination | QSVQEKRKKKEKIEK HHHHHHHHHHHHHHH | 78.31 | 33845483 | |
54 | Ubiquitination | VQEKRKKKEKIEKQI HHHHHHHHHHHHHHH | 68.24 | 24816145 | |
56 | Ubiquitination | EKRKKKEKIEKQIAT HHHHHHHHHHHHHHH | 66.11 | 24816145 | |
59 | Ubiquitination | KKKEKIEKQIATSGP HHHHHHHHHHHHCCC | 50.94 | 33845483 | |
61 | Ubiquitination | KEKIEKQIATSGPPP HHHHHHHHHHCCCCC | 7.18 | 33845483 | |
63 | Phosphorylation | KIEKQIATSGPPPEG HHHHHHHHCCCCCCC | 35.53 | 25850435 | |
64 | O-linked_Glycosylation | IEKQIATSGPPPEGG HHHHHHHCCCCCCCC | 40.04 | 28657654 | |
64 | Phosphorylation | IEKQIATSGPPPEGG HHHHHHHCCCCCCCC | 40.04 | 25850435 | |
75 | Phosphorylation | PEGGLRWTVS----- CCCCCCCCCC----- | 12.39 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SVIP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SVIP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SVIP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DERL1_HUMAN | DERL1 | physical | 17872946 | |
TERA_HUMAN | VCP | physical | 17872946 | |
SYVN1_HUMAN | SYVN1 | physical | 17872946 | |
AMFR_HUMAN | AMFR | physical | 17872946 | |
TFR1_HUMAN | TFRC | physical | 17872946 | |
UFD1_HUMAN | UFD1L | physical | 17872946 | |
CALX_HUMAN | CANX | physical | 17872946 | |
GOGA1_HUMAN | GOLGA1 | physical | 17872946 | |
NPL4_HUMAN | NPLOC4 | physical | 17872946 | |
SELS_HUMAN | VIMP | physical | 17872946 | |
TERA_HUMAN | VCP | physical | 21909394 | |
LAMP1_HUMAN | LAMP1 | physical | 21909394 | |
TERA_HUMAN | VCP | physical | 24100225 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...