UniProt ID | PRAF2_HUMAN | |
---|---|---|
UniProt AC | O60831 | |
Protein Name | PRA1 family protein 2 | |
Gene Name | PRAF2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization |
Endosome membrane Multi-pass membrane protein . |
|
Protein Description | May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptotic role in cerulenin-induced neuroblastoma apoptosis.. | |
Protein Sequence | MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSEVRLPPL ------CCCCCCCCC | 44.81 | 20071362 | |
19 | Phosphorylation | LDDFVLGSARLAAPD HCHHHHCCCHHCCCC | 13.17 | 21712546 | |
152 | Ubiquitination | LKNKIENKIESIGLK HHHHHHHHHHHCCCC | 34.75 | - | |
152 | Malonylation | LKNKIENKIESIGLK HHHHHHHHHHHCCCC | 34.75 | 26320211 | |
159 | Ubiquitination | KIESIGLKRTPMGLL HHHHCCCCCCHHHHH | 49.35 | - | |
161 | Phosphorylation | ESIGLKRTPMGLLLE HHCCCCCCHHHHHHH | 18.95 | 24719451 | |
178 | Phosphorylation | GQEQEAGS------- HHHHHCCC------- | 44.06 | 26846344 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRAF2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRAF2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRAF2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRAF2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...