UniProt ID | MSPD1_HUMAN | |
---|---|---|
UniProt AC | Q9UJG1 | |
Protein Name | Motile sperm domain-containing protein 1 | |
Gene Name | MOSPD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation.. | |
Protein Sequence | MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Ubiquitination | YEFALKFKVLCTTPN HHHHHEEEEEECCCC | 32.48 | 29967540 | |
51 | Malonylation | YEFALKFKVLCTTPN HHHHHEEEEEECCCC | 32.48 | 26320211 | |
56 | Phosphorylation | KFKVLCTTPNKYVVV EEEEEECCCCCEEEE | 24.70 | 25159151 | |
103 | Phosphorylation | RLQVSEQSQRKALGR HHCCCHHHHHHHCCC | 28.09 | - | |
111 | Ubiquitination | QRKALGRKEVVATLL HHHHCCCHHHHHHHC | 53.73 | 29967540 | |
116 | Phosphorylation | GRKEVVATLLPSAKE CCHHHHHHHCHHHHH | 19.74 | 22210691 | |
120 | Phosphorylation | VVATLLPSAKEQQKE HHHHHCHHHHHHHHH | 52.52 | 24719451 | |
122 | Ubiquitination | ATLLPSAKEQQKEEE HHHCHHHHHHHHHHH | 61.46 | 32015554 | |
126 | Ubiquitination | PSAKEQQKEEEEKRL HHHHHHHHHHHHHHH | 67.78 | - | |
131 | Ubiquitination | QQKEEEEKRLKEHLT HHHHHHHHHHHHHHH | 67.33 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSPD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSPD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSPD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MSPD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...