| UniProt ID | TI17B_HUMAN | |
|---|---|---|
| UniProt AC | O60830 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit Tim17-B | |
| Gene Name | TIMM17B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 172 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
| Protein Description | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.. | |
| Protein Sequence | MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Ubiquitination | GGVFQAIKGFRNAPV HHHHHHHHCCCCCCC | 55.82 | - | |
| 49 | Methylation | VGIRHRLRGSANAVR CCHHHHHCCCCCEEE | 36.66 | 80701409 | |
| 56 | Methylation | RGSANAVRIRAPQIG CCCCCEEEEECCCCC | 15.40 | 115918501 | |
| 86 | Ubiquitination | GLVRLRGKEDPWNSI CEEECCCCCCCCCHH | 53.13 | 21963094 | |
| 134 | Phosphorylation | EGVGILLTRYTAQQF HHHHHHHHHHHHHHH | 20.41 | - | |
| 136 | Ubiquitination | VGILLTRYTAQQFRN HHHHHHHHHHHHHHC | 10.95 | 21963094 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TI17B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TI17B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TI17B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| TOM20_HUMAN | TOMM20 | physical | 22939629 | |
| TIM23_HUMAN | TIMM23 | physical | 23263864 | |
| TIM50_HUMAN | TIMM50 | physical | 23263864 | |
| DJC15_HUMAN | DNAJC15 | physical | 23263864 | |
| TIM16_HUMAN | PAM16 | physical | 23263864 | |
| CREB3_HUMAN | CREB3 | physical | 21516116 | |
| TT30B_HUMAN | TTC30B | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
