| UniProt ID | TT30B_HUMAN | |
|---|---|---|
| UniProt AC | Q8N4P2 | |
| Protein Name | Tetratricopeptide repeat protein 30B | |
| Gene Name | TTC30B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 665 | |
| Subcellular Localization | Cell projection, cilium. | |
| Protein Description | Required for polyglutamylation of axonemal tubulin. Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.. | |
| Protein Sequence | MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEIIGWNI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Phosphorylation | GEFTAVVYRLIRNAR CCHHHHHHHHHHCHH | 7.97 | - | |
| 56 | Phosphorylation | SLLGYCYYRLQEFAL HHHHHHHHHHHHHHH | 10.98 | - | |
| 111 | Phosphorylation | LLLDNPAYHSRVLRL HHCCCHHHHHHHHHH | 11.11 | 23879269 | |
| 123 | Ubiquitination | LRLQAAIKYSEGDLP HHHHHHHHHCCCCCC | 37.69 | - | |
| 209 | Ubiquitination | RQYASALKHIAEIIE HHHHHHHHHHHHHHH | 32.45 | - | |
| 231 | Phosphorylation | ELGVGMTTEGIDVRS CCCCCCCCCCCEEEC | 24.26 | 24719451 | |
| 422 | Ubiquitination | EYDETMEKYIPVLMA HHHHHHHHHHHHHHH | 37.34 | 29967540 | |
| 449 | Ubiquitination | MVEKIFRKSVEFCND HHHHHHHHHCCCCCC | 48.37 | 29967540 | |
| 475 | Phosphorylation | LFMQENKYKEAIGFY HHHCCCCHHHHHCCC | 26.16 | - | |
| 476 | Ubiquitination | FMQENKYKEAIGFYE HHCCCCHHHHHCCCH | 42.13 | 29967540 | |
| 487 | Ubiquitination | GFYEPIVKKHYDNIL CCCHHHHHHHHHCHH | 34.25 | 29967540 | |
| 488 | Ubiquitination | FYEPIVKKHYDNILN CCHHHHHHHHHCHHC | 36.18 | - | |
| 569 | Ubiquitination | FGISRVIKSLEPYNK HCHHHHHHHCCCHHC | 46.24 | 29967540 | |
| 577 | Ubiquitination | SLEPYNKKLGTDTWY HCCCHHCCCCCCHHH | 48.81 | - | |
| 587 | Ubiquitination | TDTWYYAKRCFLSLL CCHHHHHHHHHHHHH | 33.31 | - | |
| 643 | Ubiquitination | EERMHVGKNTVTYES HHHCCCCCCCCCHHH | 48.64 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TT30B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TT30B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TT30B_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
