UniProt ID | TT30B_HUMAN | |
---|---|---|
UniProt AC | Q8N4P2 | |
Protein Name | Tetratricopeptide repeat protein 30B | |
Gene Name | TTC30B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 665 | |
Subcellular Localization | Cell projection, cilium. | |
Protein Description | Required for polyglutamylation of axonemal tubulin. Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.. | |
Protein Sequence | MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEIIGWNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | GEFTAVVYRLIRNAR CCHHHHHHHHHHCHH | 7.97 | - | |
56 | Phosphorylation | SLLGYCYYRLQEFAL HHHHHHHHHHHHHHH | 10.98 | - | |
111 | Phosphorylation | LLLDNPAYHSRVLRL HHCCCHHHHHHHHHH | 11.11 | 23879269 | |
123 | Ubiquitination | LRLQAAIKYSEGDLP HHHHHHHHHCCCCCC | 37.69 | - | |
209 | Ubiquitination | RQYASALKHIAEIIE HHHHHHHHHHHHHHH | 32.45 | - | |
231 | Phosphorylation | ELGVGMTTEGIDVRS CCCCCCCCCCCEEEC | 24.26 | 24719451 | |
422 | Ubiquitination | EYDETMEKYIPVLMA HHHHHHHHHHHHHHH | 37.34 | 29967540 | |
449 | Ubiquitination | MVEKIFRKSVEFCND HHHHHHHHHCCCCCC | 48.37 | 29967540 | |
475 | Phosphorylation | LFMQENKYKEAIGFY HHHCCCCHHHHHCCC | 26.16 | - | |
476 | Ubiquitination | FMQENKYKEAIGFYE HHCCCCHHHHHCCCH | 42.13 | 29967540 | |
487 | Ubiquitination | GFYEPIVKKHYDNIL CCCHHHHHHHHHCHH | 34.25 | 29967540 | |
488 | Ubiquitination | FYEPIVKKHYDNILN CCHHHHHHHHHCHHC | 36.18 | - | |
569 | Ubiquitination | FGISRVIKSLEPYNK HCHHHHHHHCCCHHC | 46.24 | 29967540 | |
577 | Ubiquitination | SLEPYNKKLGTDTWY HCCCHHCCCCCCHHH | 48.81 | - | |
587 | Ubiquitination | TDTWYYAKRCFLSLL CCHHHHHHHHHHHHH | 33.31 | - | |
643 | Ubiquitination | EERMHVGKNTVTYES HHHCCCCCCCCCHHH | 48.64 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TT30B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TT30B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TT30B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...