| UniProt ID | IFT27_HUMAN | |
|---|---|---|
| UniProt AC | Q9BW83 | |
| Protein Name | Intraflagellar transport protein 27 homolog | |
| Gene Name | IFT27 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 186 | |
| Subcellular Localization | Cell projection, cilium . | |
| Protein Description | Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6. [PubMed: 25443296 Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6] | |
| Protein Sequence | MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Ubiquitination | -MVKLAAKCILAGDP -CCHHHHHHHHHCCC | 19.05 | 29967540 | |
| 18 | Ubiquitination | AGDPAVGKTALAQIF HCCCCCCHHHHHHHH | 24.83 | - | |
| 40 | Phosphorylation | QKSYTLTTGMDLVVK EEEEEECCCCEEEEE | 33.35 | - | |
| 109 | Phosphorylation | KWLEKARSQAPGISL HHHHHHHHCCCCCCC | 35.24 | 20068231 | |
| 115 | Phosphorylation | RSQAPGISLPGVLVG HHCCCCCCCCCEEEC | 34.13 | 20068231 | |
| 123 | Ubiquitination | LPGVLVGNKTDLAGR CCCEEECCCCCCCCC | 36.25 | 29967540 | |
| 124 | Ubiquitination | PGVLVGNKTDLAGRR CCEEECCCCCCCCCH | 37.17 | 29967540 | |
| 149 | Glutathionylation | ALGQGLECFETSVKE HHHCCHHEEECCHHH | 4.49 | 22555962 | |
| 154 | Ubiquitination | LECFETSVKEMENFE HHEEECCHHHHHCCC | 8.75 | 32015554 | |
| 155 | Ubiquitination | ECFETSVKEMENFEA HEEECCHHHHHCCCC | 51.62 | 32015554 | |
| 157 | Sulfoxidation | FETSVKEMENFEAPF EECCHHHHHCCCCHH | 4.17 | 30846556 | |
| 177 | Ubiquitination | QFHQLYREKVEVFRA HHHHHHHHHHHHHHH | 48.15 | 29967540 | |
| 178 | Ubiquitination | FHQLYREKVEVFRAL HHHHHHHHHHHHHHH | 34.40 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFT27_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFT27_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFT27_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IFT25_HUMAN | HSPB11 | physical | 16189514 | |
| IFT25_HUMAN | HSPB11 | physical | 25416956 | |
| UBX10_HUMAN | UBXN10 | physical | 26389662 | |
| IFT46_HUMAN | IFT46 | physical | 27173435 | |
| IFT74_HUMAN | IFT74 | physical | 27173435 | |
| IFT22_HUMAN | IFT22 | physical | 27173435 | |
| IF172_HUMAN | IFT172 | physical | 27173435 | |
| IFT52_HUMAN | IFT52 | physical | 27173435 | |
| LCA5_HUMAN | LCA5 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 615996 | Bardet-Biedl syndrome 19 (BBS19) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
