| UniProt ID | IFT25_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y547 | |
| Protein Name | Intraflagellar transport protein 25 homolog | |
| Gene Name | HSPB11 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 144 | |
| Subcellular Localization | Cell projection, cilium. | |
| Protein Description | Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly (By similarity).. | |
| Protein Sequence | MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 76 | Ubiquitination | VQTLKIEKSTSKEPV EEEEEEEECCCCCCC | 22817900 | ||
| 77 | Phosphorylation | QTLKIEKSTSKEPVD EEEEEEECCCCCCCC | 30622161 | ||
| 78 | Phosphorylation | TLKIEKSTSKEPVDF EEEEEECCCCCCCCH | 30622161 | ||
| 79 | Phosphorylation | LKIEKSTSKEPVDFE EEEEECCCCCCCCHH | 30622161 | ||
| 80 | Ubiquitination | KIEKSTSKEPVDFEQ EEEECCCCCCCCHHH | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFT25_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFT25_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFT25_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IFT27_HUMAN | IFT27 | physical | 27173435 | |
| IFT52_HUMAN | IFT52 | physical | 27173435 | |
| IFT74_HUMAN | IFT74 | physical | 27173435 | |
| IFT20_HUMAN | IFT20 | physical | 27173435 | |
| IF172_HUMAN | IFT172 | physical | 27173435 | |
| IFT46_HUMAN | IFT46 | physical | 27173435 | |
| LCA5_HUMAN | LCA5 | physical | 27173435 | |
| IFT22_HUMAN | IFT22 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...