UniProt ID | DJC15_HUMAN | |
---|---|---|
UniProt AC | Q9Y5T4 | |
Protein Name | DnaJ homolog subfamily C member 15 | |
Gene Name | DNAJC15 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 150 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.. | |
Protein Sequence | MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Ubiquitination | EYLQPSAKRPDADVD HHHCCCCCCCCCCHH | 69.65 | 32142685 | |
76 | Phosphorylation | TETAKKISTPSFSSY HHHHHHCCCCCHHHH | 43.05 | 29209046 | |
77 | Phosphorylation | ETAKKISTPSFSSYY HHHHHCCCCCHHHHH | 26.82 | 29209046 | |
79 | Phosphorylation | AKKISTPSFSSYYKG HHHCCCCCHHHHHCC | 37.54 | 29209046 | |
81 | Phosphorylation | KISTPSFSSYYKGGF HCCCCCHHHHHCCCH | 23.05 | 29209046 | |
82 | Phosphorylation | ISTPSFSSYYKGGFE CCCCCHHHHHCCCHH | 30.39 | 29209046 | |
83 | Phosphorylation | STPSFSSYYKGGFEQ CCCCHHHHHCCCHHH | 14.16 | 29209046 | |
84 | Phosphorylation | TPSFSSYYKGGFEQK CCCHHHHHCCCHHHH | 12.71 | 29209046 | |
104 | Phosphorylation | AGLILGVSPSAGKAK CCEEEEECCCCCHHH | 16.02 | 30266825 | |
104 | O-linked_Glycosylation | AGLILGVSPSAGKAK CCEEEEECCCCCHHH | 16.02 | 18669648 | |
106 | Phosphorylation | LILGVSPSAGKAKIR EEEEECCCCCHHHHH | 41.99 | 30266825 | |
106 | O-linked_Glycosylation | LILGVSPSAGKAKIR EEEEECCCCCHHHHH | 41.99 | 46199891 | |
127 | Acetylation | MILNHPDKGGSPYVA EEECCCCCCCCCCHH | 70.40 | 26051181 | |
141 | Acetylation | AAKINEAKDLLETTT HHHHHHHHHHHHHHC | 42.61 | 26051181 | |
147 | O-linked_Glycosylation | AKDLLETTTKH---- HHHHHHHHCCC---- | 25.19 | OGP | |
148 | O-linked_Glycosylation | KDLLETTTKH----- HHHHHHHCCC----- | 34.24 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DJC15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DJC15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DJC15_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FAM9B_HUMAN | FAM9B | physical | 25416956 | |
TIM16_HUMAN | PAM16 | physical | 23263864 | |
DJC15_HUMAN | DNAJC15 | physical | 23263864 | |
TI17A_HUMAN | TIMM17A | physical | 23263864 | |
TI17B_HUMAN | TIMM17B | physical | 23263864 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104, AND MASSSPECTROMETRY. |