dbPTM

DJC15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DJC15_HUMAN
UniProt AC	Q9Y5T4
Protein Name	DnaJ homolog subfamily C member 15
Gene Name	DNAJC15
Organism	Homo sapiens (Human).
Sequence Length	150
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein .
Protein Description	Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9..
Protein Sequence	MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Ubiquitination	EYLQPSAKRPDADVD HHHCCCCCCCCCCHH	69.65	32142685
76	Phosphorylation	TETAKKISTPSFSSY HHHHHHCCCCCHHHH	43.05	29209046
77	Phosphorylation	ETAKKISTPSFSSYY HHHHHCCCCCHHHHH	26.82	29209046
79	Phosphorylation	AKKISTPSFSSYYKG HHHCCCCCHHHHHCC	37.54	29209046
81	Phosphorylation	KISTPSFSSYYKGGF HCCCCCHHHHHCCCH	23.05	29209046
82	Phosphorylation	ISTPSFSSYYKGGFE CCCCCHHHHHCCCHH	30.39	29209046
83	Phosphorylation	STPSFSSYYKGGFEQ CCCCHHHHHCCCHHH	14.16	29209046
84	Phosphorylation	TPSFSSYYKGGFEQK CCCHHHHHCCCHHHH	12.71	29209046
104	Phosphorylation	AGLILGVSPSAGKAK CCEEEEECCCCCHHH	16.02	30266825
104	O-linked_Glycosylation	AGLILGVSPSAGKAK CCEEEEECCCCCHHH	16.02	18669648
106	Phosphorylation	LILGVSPSAGKAKIR EEEEECCCCCHHHHH	41.99	30266825
106	O-linked_Glycosylation	LILGVSPSAGKAKIR EEEEECCCCCHHHHH	41.99	46199891
127	Acetylation	MILNHPDKGGSPYVA EEECCCCCCCCCCHH	70.40	26051181
141	Acetylation	AAKINEAKDLLETTT HHHHHHHHHHHHHHC	42.61	26051181
147	O-linked_Glycosylation	AKDLLETTTKH---- HHHHHHHHCCC----	25.19	OGP
148	O-linked_Glycosylation	KDLLETTTKH----- HHHHHHHCCC-----	34.24	OGP

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DJC15_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DJC15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DJC15_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FAM9B_HUMAN	FAM9B	physical	25416956
TIM16_HUMAN	PAM16	physical	23263864
DJC15_HUMAN	DNAJC15	physical	23263864
TI17A_HUMAN	TIMM17A	physical	23263864
TI17B_HUMAN	TIMM17B	physical	23263864

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DJC15_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104, AND MASSSPECTROMETRY.	18669648 [Abstract]