| UniProt ID | TI17A_HUMAN | |
|---|---|---|
| UniProt AC | Q99595 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit Tim17-A | |
| Gene Name | TIMM17A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 171 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
| Protein Description | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.. | |
| Protein Sequence | MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Ubiquitination | GGIFQAIKGFRNSPV HHHHHHHHCCCCCCC | 55.82 | - | |
| 40 | Phosphorylation | AIKGFRNSPVGVNHR HHHCCCCCCCCCCHH | 19.39 | 29214152 | |
| 56 | Ubiquitination | RGSLTAIKTRAPQLG HCCEEEHHHCCCCCC | 29.51 | 21906983 | |
| 86 | Ubiquitination | SMVQVRGKEDPWNSI EEEEECCCCCCCCHH | 48.67 | 21906983 | |
| 162 | Phosphorylation | PSTQLPSSPFGDYRQ CCCCCCCCCCCCCCC | 23.47 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TI17A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TI17A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TI17A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TIM44_HUMAN | TIMM44 | physical | 20053669 | |
| TIM16_HUMAN | PAM16 | physical | 20053669 | |
| TIM14_HUMAN | DNAJC19 | physical | 20053669 | |
| TBA1A_HUMAN | TUBA1A | physical | 21900206 | |
| ELOV5_HUMAN | ELOVL5 | physical | 27173435 | |
| ROMO1_HUMAN | ROMO1 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
