| UniProt ID | ULBP2_HUMAN | |
|---|---|---|
| UniProt AC | Q9BZM5 | |
| Protein Name | UL16-binding protein 2 | |
| Gene Name | ULBP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 246 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . Endoplasmic reticulum . Secreted . In CMV-infected fibroblasts, detected in the endoplasmic reticulum/cis-Golgi. |
|
| Protein Description | Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.. | |
| Protein Sequence | MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MAAAAATKILLCLP -CHHHHHHHHHHHHH | 23403867 | ||
| 20 | Phosphorylation | LPLLLLLSGWSRAGR HHHHHHHHCCHHCCC | 25690035 | ||
| 23 | Phosphorylation | LLLLSGWSRAGRADP HHHHHCCHHCCCCCC | 25690035 | ||
| 60 | Phosphorylation | QGQVDEKTFLHYDCG ECEECCEEEEEEECC | - | ||
| 64 | Phosphorylation | DEKTFLHYDCGNKTV CCEEEEEEECCCCEE | - | ||
| 68 | N-linked_Glycosylation | FLHYDCGNKTVTPVS EEEEECCCCEEEECC | UniProtKB CARBOHYD | ||
| 72 | Phosphorylation | DCGNKTVTPVSPLGK ECCCCEEEECCCCCC | 21712546 | ||
| 75 | Phosphorylation | NKTVTPVSPLGKKLN CCEEEECCCCCCCCC | 21712546 | ||
| 79 | Ubiquitination | TPVSPLGKKLNVTTA EECCCCCCCCCCCHH | - | ||
| 82 | N-linked_Glycosylation | SPLGKKLNVTTAWKA CCCCCCCCCCHHHHC | UniProtKB CARBOHYD | ||
| 84 | Phosphorylation | LGKKLNVTTAWKAQN CCCCCCCCHHHHCCC | - | ||
| 88 | Ubiquitination | LNVTTAWKAQNPVLR CCCCHHHHCCCHHHH | 27667366 | ||
| 203 | Phosphorylation | DFLMGMDSTLEPSAG HHHCCCCCCCCCCCC | - | ||
| 204 | Phosphorylation | FLMGMDSTLEPSAGA HHCCCCCCCCCCCCC | - | ||
| 216 | GPI-anchor | AGAPLAMSSGTTQLR CCCCEEECCCCHHHH | 11239445 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ULBP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ULBP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ULBP2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ULBP2_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
