TMM11_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TMM11_HUMAN
• UniProt AC: P17152
• Protein Name: Transmembrane protein 11, mitochondrial
• Gene Name: TMEM11
• Organism: Homo sapiens (Human).
• Sequence Length: 192
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Plays a role in mitochondrial morphogenesis..
• Protein Sequence: MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	RRRLGPGSSGGSARE CCCCCCCCCCCCHHH	29.01	29255136
14	Phosphorylation	RRLGPGSSGGSARER CCCCCCCCCCCHHHH	53.76	29255136
17	Phosphorylation	GPGSSGGSARERVSL CCCCCCCCHHHHCCC	27.90	29255136
25	Phosphorylation	ARERVSLSATDCYIV HHHHCCCCCCCEEEE	22.93	24275569
65	Phosphorylation	KYIVIEPTRIGDETA CEEEECCCCCCCCCC	23.33	27251275
138	Phosphorylation	CCKYQVEYDAYKLSR CCCEEEEEEEEHHCC	13.66	23312004
141	Phosphorylation	YQVEYDAYKLSRLPL EEEEEEEEHHCCCCC	15.01	23312004
142	Ubiquitination	QVEYDAYKLSRLPLH EEEEEEEHHCCCCCC	41.53	21963094
142	Malonylation	QVEYDAYKLSRLPLH EEEEEEEHHCCCCCC	41.53	26320211
144	Phosphorylation	EYDAYKLSRLPLHTL EEEEEHHCCCCCCCC	27.85	28857561
150	Phosphorylation	LSRLPLHTLTSSTPV HCCCCCCCCCCCCCE	39.14	24719451
152	Phosphorylation	RLPLHTLTSSTPVVL CCCCCCCCCCCCEEE	23.06	28348404
153	Phosphorylation	LPLHTLTSSTPVVLV CCCCCCCCCCCEEEE	35.01	24719451
154	Phosphorylation	PLHTLTSSTPVVLVR CCCCCCCCCCEEEEE	31.34	-
155	Phosphorylation	LHTLTSSTPVVLVRK CCCCCCCCCEEEEEC	21.62	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TMM11_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TMM11_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TMM11_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUV91_HUMAN	SUV39H1	physical	23455924
FATE1_HUMAN	FATE1	physical	21516116
CR3L1_HUMAN	CREB3L1	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.