UniProt ID | TMM11_HUMAN | |
---|---|---|
UniProt AC | P17152 | |
Protein Name | Transmembrane protein 11, mitochondrial | |
Gene Name | TMEM11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 192 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Plays a role in mitochondrial morphogenesis.. | |
Protein Sequence | MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | RRRLGPGSSGGSARE CCCCCCCCCCCCHHH | 29.01 | 29255136 | |
14 | Phosphorylation | RRLGPGSSGGSARER CCCCCCCCCCCHHHH | 53.76 | 29255136 | |
17 | Phosphorylation | GPGSSGGSARERVSL CCCCCCCCHHHHCCC | 27.90 | 29255136 | |
25 | Phosphorylation | ARERVSLSATDCYIV HHHHCCCCCCCEEEE | 22.93 | 24275569 | |
65 | Phosphorylation | KYIVIEPTRIGDETA CEEEECCCCCCCCCC | 23.33 | 27251275 | |
138 | Phosphorylation | CCKYQVEYDAYKLSR CCCEEEEEEEEHHCC | 13.66 | 23312004 | |
141 | Phosphorylation | YQVEYDAYKLSRLPL EEEEEEEEHHCCCCC | 15.01 | 23312004 | |
142 | Ubiquitination | QVEYDAYKLSRLPLH EEEEEEEHHCCCCCC | 41.53 | 21963094 | |
142 | Malonylation | QVEYDAYKLSRLPLH EEEEEEEHHCCCCCC | 41.53 | 26320211 | |
144 | Phosphorylation | EYDAYKLSRLPLHTL EEEEEHHCCCCCCCC | 27.85 | 28857561 | |
150 | Phosphorylation | LSRLPLHTLTSSTPV HCCCCCCCCCCCCCE | 39.14 | 24719451 | |
152 | Phosphorylation | RLPLHTLTSSTPVVL CCCCCCCCCCCCEEE | 23.06 | 28348404 | |
153 | Phosphorylation | LPLHTLTSSTPVVLV CCCCCCCCCCCEEEE | 35.01 | 24719451 | |
154 | Phosphorylation | PLHTLTSSTPVVLVR CCCCCCCCCCEEEEE | 31.34 | - | |
155 | Phosphorylation | LHTLTSSTPVVLVRK CCCCCCCCCEEEEEC | 21.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SUV91_HUMAN | SUV39H1 | physical | 23455924 | |
FATE1_HUMAN | FATE1 | physical | 21516116 | |
CR3L1_HUMAN | CREB3L1 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...