OCC1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OCC1_HUMAN
• UniProt AC: Q8TAD7
• Protein Name: Overexpressed in colon carcinoma 1 protein
• Gene Name: OCC1
• Organism: Homo sapiens (Human).
• Sequence Length: 63
• Protein Sequence: MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	AGAAKDVTEESVTED CCCCCCCCCCCCCCC	44.14	28060719
28	Phosphorylation	AKDVTEESVTEDDKR CCCCCCCCCCCCHHH	28.27	23401153
30	Phosphorylation	DVTEESVTEDDKRRN CCCCCCCCCCHHHHC	42.87	29255136
38	Phosphorylation	EDDKRRNYGGVYVGL CCHHHHCCCCEEEEC	17.28	28796482
42	Phosphorylation	RRNYGGVYVGLPSEA HHCCCCEEEECCHHH	7.65	28796482
47	Phosphorylation	GVYVGLPSEAVNMVS CEEEECCHHHHHHHH	43.14	26552605
54	Phosphorylation	SEAVNMVSSQTKTVR HHHHHHHHCCCCCCC	13.13	27307780
55	Phosphorylation	EAVNMVSSQTKTVRK HHHHHHHCCCCCCCC	30.38	26552605
57	Phosphorylation	VNMVSSQTKTVRKN- HHHHHCCCCCCCCC-	30.54	26552605
58	Ubiquitination	NMVSSQTKTVRKN-- HHHHCCCCCCCCC--	37.07	-
59	Phosphorylation	MVSSQTKTVRKN--- HHHCCCCCCCCC---	29.00	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OCC1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OCC1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OCC1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PDE9A_HUMAN	PDE9A	physical	27173435

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.