UniProt ID | OCC1_HUMAN | |
---|---|---|
UniProt AC | Q8TAD7 | |
Protein Name | Overexpressed in colon carcinoma 1 protein | |
Gene Name | OCC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 63 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | AGAAKDVTEESVTED CCCCCCCCCCCCCCC | 44.14 | 28060719 | |
28 | Phosphorylation | AKDVTEESVTEDDKR CCCCCCCCCCCCHHH | 28.27 | 23401153 | |
30 | Phosphorylation | DVTEESVTEDDKRRN CCCCCCCCCCHHHHC | 42.87 | 29255136 | |
38 | Phosphorylation | EDDKRRNYGGVYVGL CCHHHHCCCCEEEEC | 17.28 | 28796482 | |
42 | Phosphorylation | RRNYGGVYVGLPSEA HHCCCCEEEECCHHH | 7.65 | 28796482 | |
47 | Phosphorylation | GVYVGLPSEAVNMVS CEEEECCHHHHHHHH | 43.14 | 26552605 | |
54 | Phosphorylation | SEAVNMVSSQTKTVR HHHHHHHHCCCCCCC | 13.13 | 27307780 | |
55 | Phosphorylation | EAVNMVSSQTKTVRK HHHHHHHCCCCCCCC | 30.38 | 26552605 | |
57 | Phosphorylation | VNMVSSQTKTVRKN- HHHHHCCCCCCCCC- | 30.54 | 26552605 | |
58 | Ubiquitination | NMVSSQTKTVRKN-- HHHHCCCCCCCCC-- | 37.07 | - | |
59 | Phosphorylation | MVSSQTKTVRKN--- HHHCCCCCCCCC--- | 29.00 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OCC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OCC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OCC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PDE9A_HUMAN | PDE9A | physical | 27173435 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...