UniProt ID | HXA1_HUMAN | |
---|---|---|
UniProt AC | P49639 | |
Protein Name | Homeobox protein Hox-A1 | |
Gene Name | HOXA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 335 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments.. | |
Protein Sequence | MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | GTCSARAYPSDHRIT CCCCCCEECCCCCEE | 9.56 | - | |
30 | Phosphorylation | CSARAYPSDHRITTF CCCCEECCCCCEEEE | 33.11 | - | |
255 | Phosphorylation | FHFNKYLTRARRVEI HHHHHHHHHHHHHHH | 21.13 | - | |
296 | Phosphorylation | KEGLLPISPATPPGN HCCCCCCCCCCCCCC | 13.42 | 28450419 | |
299 | Phosphorylation | LLPISPATPPGNDEK CCCCCCCCCCCCCHH | 33.14 | 19664994 | |
322 | Phosphorylation | SSSPCVPSPGSSTSD CCCCCCCCCCCCCCC | 22.84 | 28450419 | |
325 | Phosphorylation | PCVPSPGSSTSDTLT CCCCCCCCCCCCCCC | 33.55 | 28450419 | |
326 | Phosphorylation | CVPSPGSSTSDTLTT CCCCCCCCCCCCCCC | 37.53 | 28450419 | |
334 | Phosphorylation | TSDTLTTSH------ CCCCCCCCC------ | 23.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXA1_HUMAN !! |
loading...