PP13_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PP13_HUMAN
• UniProt AC: Q9UHV8
• Protein Name: Galactoside-binding soluble lectin 13
• Gene Name: LGALS13
• Organism: Homo sapiens (Human).
• Sequence Length: 139
• Subcellular Localization: Cytoplasm . Nucleus matrix .
• Protein Description: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [PubMed: 10527825]
• Protein Sequence: MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PP13_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PP13_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PP13_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PP13_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PACN3_HUMAN	PACSIN3	physical	25416956
NUFP2_HUMAN	NUFIP2	physical	25416956
CREB5_HUMAN	CREB5	physical	21516116
CENPV_HUMAN	CENPV	physical	28514442
UBB_HUMAN	UBB	physical	28514442
DNPEP_HUMAN	DNPEP	physical	28514442
RPA1_HUMAN	POLR1A	physical	28514442
BTBD1_HUMAN	BTBD1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.